KEGG   Takifugu rubripes (torafugu): 115252790
Entry
115252790         CDS       T02386                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00100  Steroid biosynthesis
tru01100  Metabolic pathways
Module
tru_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    115252790
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     115252790
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT DUF4083
Other DBs
NCBI-GeneID: 115252790
NCBI-ProteinID: XP_029704801
Position
15
AA seq 425 aa
MKPTIQALKNKTSHDAQREFGGTLGALFIPTLLPLTVLFLTSVSRSSEASVLCWPPPLPS
AEQLWDPLAPALLLGWISLHVVLYFMPLGKVSEGLVLRDGKRLKYPINGFHSLCISCALL
LLLMGLGAQLGSVFDLLLPLAMCSIALSFLLSIYLYIRSFWAPSHALALGGNTGNPLYDF
FIGRELNPRVGNFDLKYFCELRPGLIGWVVVNLGMLMKEVELRGSPSLAMILVNSFQLLY
VADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYSLQAAFLVVHPQTLSFLGAACI
IALNGIGYYIFRKSNSQKNQFRRDPSHPSVARLETIATATGKRLLVSGWWGLVRHPNYLG
DLLMALAWSLPCGFSHLLPYFYIIYFTILLIHREDRDERQCRAKYGLAWDTYCRRVPYRI
FPYIY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaagccaaccattcaagcactgaagaacaaaacctcccatgatgctcagagagagttt
ggaggaacgctgggtgccctgttcattcccaccttacttcccttgacggtcctgttcctg
acctctgtgagtcggtcctccgaggccagtgtgctctgctggccccctcctctaccctca
gctgagcagttgtgggaccctctggcccctgcgctgctgctgggctggatcagcctgcat
gttgtcctctatttcatgccacttggaaaggtgtctgaaggactagtgctgagggacgga
aagcgtcttaaatatcctataaatgggttccacagcctatgcatcagctgcgcgttgttg
ctattgttgatgggtctcggtgcccagctggggtctgtgttcgacctgctgttgcctctg
gccatgtgctcaatagcgctgtcgttcctgctctccatctacctctacatccgttccttc
tgggctccttctcatgctctcgctttaggaggcaatacaggaaaccctctgtatgatttc
ttcattggtcgggaactgaacccaagagttggaaactttgacttgaagtatttctgcgag
ctcaggccaggtctgattggctgggtggttgtaaatctcggcatgttgatgaaggaggtg
gagcttcgaggttccccgtcactcgccatgattctggtcaacagtttccagctgctgtat
gtggccgatgccctgtggaatgaggaggctgttctaacaaccatggacatcgtgcatgat
ggttttggcttcatgctggtgtttggagacctggcctgggttcccttcacatacagcctg
caggctgccttcctggtggtgcacccacagaccctcagtttcctcggagcagcttgtata
atcgcgctcaatggtattggatattatattttcagaaagtccaactcacagaagaaccag
ttcaggcgagacccttcacatccaagcgtagcaagactggagaccatcgccacggcaaca
ggaaagcgactgctagtgtcaggctggtggggtcttgttcgtcatcccaattacctcggt
gacctgctcatggccctggcgtggtctctgccatgtggattctcacaccttctgccttac
ttctacatcatttatttcaccatcctgctgattcaccgagaggaccgggatgagagacag
tgcagagccaagtatggactagcgtgggacacctactgtcgacgtgtcccctacaggatc
ttcccttacatatactga

DBGET integrated database retrieval system