KEGG   Takifugu rubripes (torafugu): 446049Help
Entry
446049            CDS       T02386                                 

Gene name
pah
Definition
(RefSeq) phenylalanine hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00360  Phenylalanine metabolism
tru00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tru00790  Folate biosynthesis
tru01100  Metabolic pathways
tru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    446049 (pah)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    446049 (pah)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    446049 (pah)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     446049 (pah)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT ACT_4
Motif
Other DBs
NCBI-GeneID: 446049
NCBI-ProteinID: NP_001027850
UniProt: Q6IVY7
Position
18
AA seq 454 aa AA seqDB search
MRNMRAARPEVGLNVFVQKRIGSMYLEEEIGRKFEVISCIFSLKQEVGPLTKALKLFEEK
GINLTHIESRPSRTNTGQYEFFINVDTSCSQALDEVIDSLRTEISGHVHELSRNKEKDTV
PWFPNDIQDLDRFANQILSYGSELDSDHPGFTDQVYRLRRKEFADIAYNYRHGQPIPRVE
YTEDEKATWGKVFRELKTLYPTHACREHNRVFPLLEKYCGYKEDNIPQLEDVSRFLQSCT
GFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHSSRPTYTPEPDVCHELLGHVPLFADSS
FAQFSQEIGLASLGAPDEYIEKLATVYWFTVEFGLCNQGSEIRAFGAGLLSSFGELQYCL
TDKPKILPFDPDKTCLQKYPITEYQPVYFVADSFENAKEKVRKFAATIPKPFSVRYNPYT
QSVEVLDDTKQLTNLADCISSEMGKLCEALRKLQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacatgcgagctgcgagacctgaggtgggattaaatgtgtttgtgcagaagaga
ataggctccatgtacctggaggaggaaataggcaggaaattcgaggttatctcctgcatt
ttttccctgaaacaagaagttggccccctaaccaaggccctaaagctttttgaggagaaa
ggcatcaacctcacccacatcgagtctcgtccctcgcgcacaaacacaggccagtatgag
ttcttcatcaacgtggacacttcctgctcccaggctctggacgaggtcatcgacagcctg
cgtacagagatcagtggccacgtgcacgagctgtcacgcaacaaagagaaggacacagtt
ccgtggttccctaatgacatccaggacttagaccgcttcgccaaccagatcctcagctac
ggctcagagctggattctgatcaccctggtttcacagatcaggtgtacagactccgcagg
aaagagtttgctgacatcgcctacaactacagacatggccagcctatcccacgagtggag
tacacagaagatgaaaaggccacatggggaaaagtgttcagggaactgaagaccttgtac
ccgacgcacgcctgccgcgagcacaaccgcgttttccccctgctggagaaatactgcggc
tacaaggaggacaacatcccgcagctggaggatgtgtctcgattccttcagtcgtgcaca
ggtttccggctgcgcccggtggccggcctcctctcatcccgggacttcctggccgggctg
gccttccgggtcttccattctacgcagtacatccgtcacagctccaggcccacgtacacg
cctgaaccggacgtctgccacgagctgctgggccacgttcctctgtttgccgactccagc
tttgctcagttctcacaggaaatcggtctcgcctctcttggagctcctgatgagtacatt
gagaaactcgccactgtgtactggttcaccgtggagttcgggttgtgcaatcagggctct
gagatcagagctttcggagccggcttgctgtcatccttcggcgagctgcagtactgcctg
acggacaagcccaaaattctgccctttgaccccgacaagacctgcctccagaaatacccc
atcacagagtaccagcctgtttactttgttgccgacagcttcgaaaatgccaaagagaaa
gtgaggaaattcgccgccaccatcccgaagccgttctcggtgcgctacaatccctacacc
cagagcgttgaagtgctggacgacaccaagcagctcaccaatctggccgactgcatcagc
agtgaaatgggcaaactgtgtgaagccctgcgtaaactgcagtaa

DBGET integrated database retrieval system