KEGG   Takifugu rubripes (torafugu): 446090Help
Entry
446090            CDS       T02386                                 

Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-2
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    446090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tru04040]
    446090
Ion channels [BR:tru04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   446090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 446090
NCBI-ProteinID: XP_029690422
Position
3
AA seq 640 aa AA seqDB search
MMDLYKHILLFFALIPQGFSQVAPRAHAEERLLQDLFAHYNKLSRPVENTTDTVLVHFGL
SIAQLIDVDEKNQMMTTNVWVKQEWNDYKLRWNPEEYENVTSIRIPSEIIWRPDIVLYNN
ADGDFAVTHLTKAQLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDRAK
IDLISMASDVDQMDYWESGEWVIVNAVGKYNTKKYECCTEIYSDITYYFIIRRLPLFYTI
NLIIPCLLISCLTVLVFYLPSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGE
YLLFTMVFVTLSIIITVFVLNVHHRSPQTHGMPHWVRRVFLDFVPKVLFMKRPPGTAKQH
CKKLIEMMHRPATVSGPGNSQPFWTGLETELRQMGPVHRTIPKALTDSPSIHVSSPSPPS
SPLANCNKDNQSLNANTFCQSISGRYSLLSEKQLLHGHKSAASSSSQLSLPPTLPLGLLH
KRTNKESNTMASIGRSLSVEHMFDGQKEAPCRGRYRRRSRSFQYCCLHDEGAGLTRATWG
QKKHPSADHLVEIIMAESTKDTSSLQDFEVSTISPAMQRAIEGVQYIADHLRAEDADFSV
KEDWKYVAMVIDRIFLWMFVLVCILGSVGLFLPPWLAGMI
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgatggatttatacaaacatattttactcttctttgcacttattcctcaaggcttttcc
caagttgcacctcgtgcccatgctgaagagcgactgcttcaggatctgtttgcgcattac
aacaagctctcccggcctgtggaaaacactacagacacggtgctagtgcactttgggctg
tctattgcccagcttattgatgtggatgaaaagaaccagatgatgacaacaaatgtctgg
gtgaaacaagaatggaatgattacaagctccgctggaacccagaggaatatgaaaatgtc
acctccatccgtattccctcagaaatcatctggcggcctgacattgtcctctacaacaac
gccgacggcgactttgccgtaactcacctgacaaaggctcagctgttctacgatggtcga
ataaagtggatgcccccggccatttacaagtcttcttgcagtatagacgtcacctttttc
ccgtttgaccagcaaagctgcaaaatgaagtttggttcgtggacatatgaccgtgccaaa
attgatctgatcagcatggcaagcgatgtggaccagatggattactgggagagcggcgag
tgggtcattgtcaacgcagtgggcaagtacaatacgaaaaaatacgagtgctgcacggag
atctattcggacatcacgtattacttcatcatccggaggcttccattgttctacacaatc
aacctcatcatcccctgccttctcatctcctgcttgactgtgctggtcttttatttgcct
tcacaatgtggagagaagatcaccttatgtatctcagtgctactgtctctgaccgtgttc
ctccttctgatcacggagatcattccatcaacgtctctggtgatcccattgataggtgaa
tacttgctgttcaccatggtctttgtcaccctctccatcataattactgtcttcgttttg
aacgtacaccatcgatcgccacagacccacggcatgccgcactgggtgaggagagtgttc
ttggactttgtacccaaagttctcttcatgaagcgtccaccaggcacagccaagcagcac
tgcaaaaagcttatcgagatgatgcaccgtcctgccaccgtgtcaggaccgggaaattcg
caacccttctggacagggctggagacagaactgagacagatgggcccggtccacagaaca
atcccaaaggctctcactgatagtccaagcatccatgtcagctcgccctctccaccctct
tcccctctcgcaaactgtaataaggacaatcaatcactgaatgccaacaccttctgccag
tccatatcgggacggtattcacttctgtcagagaaacaactcctgcatggacataaatca
gctgcctcgtcttcttcccagttatcgttaccccccacattgccactgggactacttcac
aaacgaaccaacaaagaatccaacaccatggcttcaattggacgctccctcagtgtggaa
cacatgtttgatggccaaaaagaggcgccttgcaggggcaggtatcggcgtcgctcccga
agcttccagtactgttgtctgcatgatgaaggagcagggctcacaagagccacgtggggg
cagaagaaacatccttctgcagatcatctagttgaaataataatggcagaatcgacaaaa
gacacaagctcactgcaagactttgaggtttcaacaatttccccagctatgcagcgggcc
atagaaggagtccagtacattgctgaccatctcagagcagaggatgccgacttttcggta
aaggaggactggaagtacgtggccatggtcattgacaggatattcctctggatgtttgtt
ttggtttgcatactgggatctgttggactttttcttcctccttggctggctggaatgatc
taa

DBGET integrated database retrieval system