KEGG   Takifugu rubripes (torafugu): 654288
Entry
654288            CDS       T02386                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    654288 (ahrr)
Transcription factors [BR:tru03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    654288 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 654288
NCBI-ProteinID: NP_001033045
Ensembl: ENSTRUG00000003745
UniProt: Q4JHL1
Position
10
AA seq 691 aa
MIPPGDCMYAGRKRRKPIQKQKPNPSNEKTNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQVNHDKTSRKHISSPAASNPDQRKESLPLGGAVNESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQNQASSTHQDSQLAGGTGEDYVVSNLFHSTEAGGIPPELSGFLNRSFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSASGAPMPPQLALFCVAVPLLLPSITEMKMKNMLLRGKN
KGGGGGGGGGGFISALDHGKCGEHLHRHPFGGGGGGGMGDVADPLLLSCPSPGASQRGHH
TPWTPLSKDNLKYRPDDYYSQEEPLNYCKTSMAPHKGVTPGLGGGWPLRPNSGPLRAGQG
VGYVPSNRLNRAGHYGKPYGGRGGEVFVSKLYGNVQIPSDPDVYCIDLVKNENGYGECYD
GHPVPEMPPIKVEHDSDSENGCDVYGRAWAGRDPEALERRYCNGGYAQTSGLHLKSEGDY
YDPQYSPCQRGKAGISPPYNNNYQNYAVGGHVNGRLLKCDKELGGDAHFSPQRLSHSDSL
CSNQPINLMDSHVFAQEPHKAYAHQDYNKHAAYEFKGHGLIHAIKREPMDSPPWSESAQN
MSQSMMVAPRNIMPCVMSTGPHKSSPYVYMP
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgatccctccgggagactgcatgtacgcgggcaggaagaggaggaagcccatccaaaaa
cagaagccgaacccttccaatgagaagaccaacccgtccaagcgccacagggacaggctg
aacgcggagctggaccggttggccagcctgctgccgttccccccagatgtcatctccaag
ctggacaaactgtctgtactgcgccttgcagtgtcctacctccgcgtcaagagcttcttc
caagtgaaccacgacaagacctccaggaagcacatcagcagccctgcagcctccaaccct
gatcagaggaaagagagccttcctctgggcggcgccgtgaatgaaagcagcctcctcctg
gagtccctgacaggcttcgccttggtggtgagcagtgatgggatggtcttctatgcctcc
tccaccatcgtggactatctgggattccatcagaccgacgtgatgcatcagaacgtgttt
gactacatccacatcgatgaccgtcaggagttcaggcgccagctgcactgggccatgtgt
cctccacaaaaccaggcctcatcaacgcaccaggacagccagctagctggagggaccgga
gaggactacgttgtgagcaacttgttccattctacagaagccggtgggattccaccagaa
ctgtcaggcttcctcaacaggtccttcattgcccgagtccgatgcctcctggacagcact
tctggatttttgacgatgcagttccagggtcgactgaaattcctgcacggccaaaaaaag
aagtcagcctccggggcgccgatgccccctcagctggctctgttctgcgtcgcggttccc
ctcctgctgccctccatcaccgagatgaaaatgaagaacatgttactgcgtggaaagaac
aagggaggaggaggaggaggaggaggaggagggttcatctctgctctggatcacggaaag
tgtggggaacatctccacagacaccccttcggtggcggcggcggcggcgggatgggcgat
gttgcagaccctctgctcctgtcctgtccctcccctggtgcgtcccagcgcggccatcac
acaccctggaccccactctccaaagacaacctcaagtaccgccctgatgattactacagc
caggaggagccactcaattactgcaagacttccatggctccccataaaggcgtcaccccg
ggcctgggtggtggctggcctctgcggccaaactccggccccctcagagcgggtcaggga
gttggatacgtcccgtctaaccgtctgaacagagcaggtcattatgggaaaccgtacggc
ggcagaggcggcgaggtgtttgtctccaaactctacgggaacgtccagattccctcggat
ccggacgtctactgcatcgacctggtaaagaacgagaacggctacggcgaatgctacgat
ggccatcccgtccccgagatgccgcccattaaggtggagcacgactcggactctgagaac
ggctgcgacgtgtacgggagagcctgggccggtcgcgacccagaggcgctggagcggcgc
tactgcaacggcgggtacgctcaaacctccggcctccatctcaagtcggagggagattac
tacgacccgcagtactcgccctgccagcggggcaaggcgggaatcagccccccgtacaac
aacaactaccagaactatgcagtcggcggccacgtgaacggacgtctgctgaagtgtgac
aaagagctgggcggcgacgcccacttcagcccccagcggctctcccactcggactctcta
tgcagcaaccagcctatcaacctcatggactcgcacgtcttcgcccaagagcctcacaag
gcgtacgcgcaccaggactacaacaaacacgccgcctatgagttcaaagggcacggcctg
atccatgcaatcaaacgggagcccatggactcgcccccgtggtccgagagcgcccaaaac
atgagccagtccatgatggtcgccccgcggaacattatgccctgcgtgatgagcacggga
ccccacaagtccagtccctacgtttatatgccgtga

DBGET integrated database retrieval system