KEGG   Treponema sp. OMZ 804: GWP43_11915
Entry
GWP43_11915       CDS       T06435                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00230  Purine metabolism
trz01100  Metabolic pathways
trz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GWP43_11915 (xdhA)
Enzymes [BR:trz01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     GWP43_11915 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QHX44032
UniProt: A0A6P1Y528
Position
complement(2544978..2547275)
AA seq 765 aa
MIVGKAVPRVDAYDKVTGRAKYVDDYFHSDFLVAKVLHSTIANGLVKKIDTSAAEKIPGV
VKIVTCFDVPDICFPTAGHPWSTEEAHQDIADRKLLNKRVRFYGDDIAAVIAEDNVVAER
ALKAITVEYEEYPPILDVHQAMSPEATVLHEAFPGNVLKHTVFSVGEYEETPDDPDTVMF
EGDYAVSPISHCHIENPGSYAYMKGGKIIVVSSTQLPHICRRVCGQALGIDWGKIRVIKP
YIGGGFGNKQDILYEPLNAYLCTVVGGRCVQLSVSREETFMCTRTRHAMEFHMKTTVRKS
DGRFISRKMLCYSTKGGYASHGHAITANASNEFKQLYSAEKGIISEAYSVFTNHITAGAM
RAYGIPQADFALESFMDDMALKLNMDPVDLRLKNCMREGYEDPVTKIRANSDGLYQCLQK
GREVFHWDELRKKYANQTGPVRRGVGVACFNYKTGVYPISLETASARIVLNQDGSIQIQM
GATEIGQGADTVFCQMAAEVLSLPMDKVYIFSEQDTDVSPYDSAAYASRQTYVSGKAIKK
TAESLKRKILDYAAWMLDMKADELDLQHEKIIVRSTGEERLTLEEVAMESCYSMKESNHL
SAEETSHCTDNCFSFGATFVEIEVDIPVGKIKVLNILNLHDSGTLINPQLAAAQVHGGMG
MGIGAATAEQMLYDKKGKLLNGNLLDYKLPTAMDLPDLHELFIENADPTGPFGNKSLGEP
PIISQPPAIRNALLHATGVAINKLPLNPQRLFEAFSESGLLKEVI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgatagttggaaaggcggtgccccgtgtcgatgcttacgataaggtaaccggcagggca
aagtatgttgacgattattttcacagtgattttttagtcgcaaaggtattgcacagtacc
atcgcgaacgggctggtaaaaaaaatcgatacaagcgctgcggagaaaattcccggtgtg
gttaagattgttacctgtttcgatgtgccggacatttgtttcccgacagcggggcacccg
tggtctaccgaggaggcacatcaggatattgcagaccgcaagctgctcaacaaaagagta
cgcttttacggggatgatattgctgccgttattgcggaagataatgtggtcgccgaacgc
gcgttaaaggctatcaccgttgaatatgaagaatatcctcctattctggatgtgcatcaa
gcgatgtcccccgaagcaaccgttttacacgaagcgttcccgggcaacgtgctgaagcat
acggtgtttagcgtgggcgagtatgaggaaacgccggatgatcccgatacggtcatgttt
gaaggcgattatgccgtatctccgatttcgcactgccatatcgaaaatcccggctcgtat
gcctatatgaagggcggaaagattatcgtggtgtcttccacgcagctgcctcacatttgc
cgccgcgtatgcggacaggcgctcggtatcgactggggaaagatacgggttatcaagccg
tatatcggcggcggcttcggcaacaagcaggatatcctgtatgagccgctgaatgcctac
ctttgtacggtggtcggcggacggtgcgtacagctgtccgtttcgcgggaagagaccttt
atgtgtacccgcacgcgccatgcaatggaattccacatgaagacaacagtgcggaagtcg
gacggcaggttcatttcgcgcaaaatgctctgctattctacgaagggcggttacgcttcg
cacggacacgccattaccgcgaatgcctccaacgagtttaagcagctctattcggctgaa
aagggaatcatttccgaagcgtactccgtgtttaccaatcatattaccgcaggggctatg
cgcgcgtatgggattccgcaagcggattttgcccttgaatcttttatggatgatatggcg
ctcaaactgaatatggatcctgttgatttgcggctcaagaactgtatgcgggaaggatac
gaagaccctgttacaaagattagagcaaactcggatgggctctatcaatgcttgcagaaa
ggccgcgaggtgttccactgggatgagttgcggaaaaagtatgcaaatcaaacagggccg
gtgcgccgcggtgtcggagttgcctgttttaactacaaaaccggcgtttaccccatctcg
ctcgaaaccgcctccgcccgtattgtgctcaatcaggacggcagtattcaaattcagatg
ggcgcaacggaaatagggcagggcgccgatacggtgttctgccagatggctgccgaagtg
ctttcgctgccgatggataaggtctatattttttccgaacaggataccgatgtcagcccg
tacgacagcgcggcctatgcttcacggcaaacgtatgtcagcggtaaggcaattaaaaag
accgccgaatcgcttaaacgaaagatattggactatgcggcgtggatgctcgatatgaag
gccgatgaacttgatctgcagcatgaaaaaattatcgtccgcagtaccggcgaagagcgg
ctcaccttggaagaggtcgcaatggaaagctgctatagtatgaaggaatccaatcacctc
agcgcggaagaaacatcgcattgtaccgataactgcttctcgttcggcgcaacctttgtt
gagattgaggttgatattcctgtcggcaaaatcaaggtattgaatattttgaacctgcac
gacagcggcacgcttatcaatccgcagctggcagcagctcaggtacacggcggcatggga
atgggaatcggcgctgcgactgccgaacagatgctctacgataagaaaggcaagctgctg
aatgggaaccttttggactataagctgccgacggcgatggatcttcctgatttacacgag
ctgtttatcgaaaatgccgaccccaccggccccttcgggaataaatctttgggtgagccg
ccgattatttcgcagccgccggcaatccgcaatgcgctgctccatgccaccggcgttgcc
attaacaagctgccgcttaatcctcagcggctttttgaagcgttcagcgagagcgggctg
ctgaaggaggtaatctaa

DBGET integrated database retrieval system