KEGG   Terriglobus saanensis: AciPR4_1084Help
Entry
AciPR4_1084       CDS       T01408                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
tsa  Terriglobus saanensis
Pathway
tsa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AciPR4_1084
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tsa02044]
    AciPR4_1084
Secretion system [BR:tsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AciPR4_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP DUF4101
Motif
Other DBs
NCBI-ProteinID: ADV81915
UniProt: E8UX28
Position
1290972..1291463
Genome map
AA seq 163 aa AA seqDB search
MAEYGMGSLFLKLDGATGEAIEPTHKNEIPVLSFSFSGHAESGSGGTAGSSGAGAMLHGI
NVTAIMDKGLQTVGKLFCEGKHIATGVLSAMKATGTANKDYFTLKMTQVYIQSFNVNLSN
DSAIVNLTLTYAEITPNYFQQQADGSMAATTSYTFNTKSGKTT
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtacggcatgggcagtctatttttgaagcttgatggagcgacgggtgaggcg
atcgaaccaacacataagaacgaaattcctgtgttaagttttagctttagcgggcatgct
gaatccggctccgggggcacggccggttcaagtggagccggagctatgctacacggaatc
aatgttaccgcgattatggacaaaggccttcaaacggtaggcaaattgttttgcgaaggt
aaacatatagcaaccggagtgttgtctgccatgaaggctactggtactgctaacaaagat
tacttcactcttaaaatgacacaagtctacattcaaagtttcaacgtgaatttatcaaac
gactctgcgatcgtgaatcttactttgacttatgcagagatcactccgaattacttccag
cagcaggcagatggcagcatggctgccacgaccagttatacgttcaatacgaagtcgggc
aagacaacctaa

DBGET integrated database retrieval system