KEGG   Terriglobus saanensis: AciPR4_1646Help
Entry
AciPR4_1646       CDS       T01408                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00260  Glycine, serine and threonine metabolism
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01120  Microbial metabolism in diverse environments
tsa01130  Biosynthesis of antibiotics
tsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciPR4_1646
Enzymes [BR:tsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AciPR4_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADV82457
UniProt: E8V3A0
Position
1994118..1995161
Genome map
AA seq 347 aa AA seqDB search
MNEVEQQFASDNYAGICPDAWAAMDEANRGHATAYGADQWTAKASDAFRDLFETRCEIFF
AFNGTAANSLVLASLCQSYHSVICSDSAHIETDECGAPEFFSNGSKLLLAPSTNGKLTAG
AIRSIATKRSDIHFPKPRVVSITQPTEMGEVYTVDEIRAISEVCRELGLRLHMDGARFAN
ACASLDCSPAEMTWQAGVDVLCFGGTKNGMAFGEAVIFFDSSLAADFDYRCKQAGQLASK
MRFLAAPWVRMLGNGSWLRNAAHANACARRFAEAAAHVPRVHLISKVEANAVFLKMPESM
MEELRSRGWVFYTFIGGGARFMFAWDSLPVRINALVEDLKDLGRSVV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgaggttgagcagcaatttgccagcgacaattatgcggggatatgtcccgacgcc
tgggccgccatggatgaagccaaccgtggtcacgctacagcgtacggcgcggaccaatgg
accgcgaaagcttccgacgctttccgcgacttattcgagacacggtgcgaaatcttcttc
gccttcaacggcacagccgccaactcgttggttttggcgtcgctgtgtcagagctaccac
agcgtcatctgttcggactcggcgcatatagagacggatgaatgcggtgcgccggaattt
ttctccaatggatcgaagcttttactcgctccatccacaaatggcaaactcacggcaggg
gccatacgttcgattgctaccaagcgaagcgatatccacttccccaagccaagagttgtc
tccatcacccaacctacggagatgggcgaggtgtacacggtcgatgaaatccgagccatc
tccgaagtgtgccgtgagctcggtctgcgccttcacatggatggggcaagatttgccaac
gcatgcgccagtctggactgcagccccgcggagatgacctggcaagctggcgtagacgtt
ctttgttttggtggtacgaagaacggcatggcatttggtgaggcggtaatcttctttgac
tccagcctggccgcggattttgactatcgctgcaagcaggccggtcagcttgcttcgaag
atgcgctttcttgccgccccgtgggtgcgcatgttggggaacggttcttggctgcgcaac
gcggcacatgcaaacgcctgtgcgcgtcgatttgccgaggccgcggctcacgtcccaaga
gtccatttaatctcgaaggtcgaggcaaacgctgtgtttctcaaaatgccggagtcgatg
atggaagagctgcggagtagaggttgggttttctatacattcatcggaggaggcgcgcgg
ttcatgttcgcttgggactcattgccggtaagaattaatgcacttgtggaagatctgaaa
gatctgggacgctctgtggtttga

DBGET integrated database retrieval system