KEGG   Terriglobus saanensis: AciPR4_1749Help
Entry
AciPR4_1749       CDS       T01408                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00030  Pentose phosphate pathway
tsa00480  Glutathione metabolism
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01120  Microbial metabolism in diverse environments
tsa01130  Biosynthesis of antibiotics
tsa01200  Carbon metabolism
Module
tsa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tsa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AciPR4_1749
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AciPR4_1749
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tsa04147]
    AciPR4_1749
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AciPR4_1749
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AciPR4_1749
Exosome [BR:tsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AciPR4_1749
  Exosomal proteins of colorectal cancer cells
   AciPR4_1749
  Exosomal proteins of bladder cancer cells
   AciPR4_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADV82556
UniProt: E8V465
Position
2128851..2130320
Genome map
AA seq 489 aa AA seqDB search
MLDAAASGSIWILKTIKTPATTANKGIAMTNTHSDALVFFGATGDLAYKKIFPSLQAMIR
RGHLDVPVIGVAKAGWNLDQFRARAKDSVEKHGGLDADAFAKLLSLLRYVDGDYQAPETF
QAIRKELGDAKQPAHYLAIPPVLFETVVKQLAQSNCGTGARVIVEKPFGHDLASAQALNK
VLLSAFEEKDIFRIDHYLGKRPVNNLLAFRFANSFVESFWNRNYIESVQITMAEDFGIQG
RGSFYDLTGTIRDVVQNHLFQVLSNLAMEPPVRLDSDSIRNEKVKVLQAIAPISSQDLVR
GQFRGYLEEQGVAKGSQTETFAALRLEINSWRWKGVPFYIRAGKCLPVTSTEVVVRFNKP
PSVIADGSSIENHLRFRLSPEVTIAMGMMSLAPGAEGLVLQPAEMIASRSPHADEMDAYE
RVLGAAMAGDSSFFARQDYVEEAWRIVEPVLKEGTPVHTYECGTWGPSEVNQVTPPGGWS
DPAAREKLV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgctggatgctgcagcgagtgggtcgatctggattttgaaaacgattaagacgcccgcg
acaacggcgaacaaggggattgcaatgacaaatacgcactcggacgccctcgtattcttt
ggcgccacgggagatctggcctataaaaagatctttccttccctccaggcaatgatccgg
cgaggacatctggatgtgcccgtgatcggtgtcgccaaagccggatggaatctcgaccag
ttccgggctcgggcaaaagacagcgtcgagaagcacggtggtctggatgcagatgccttc
gcaaagctcttaagcctgctccgctatgtggatggcgactaccaagccccggagaccttt
caggcgatacggaaagagcttggggatgcgaagcagccggcacactacctggccatcccg
cctgttctctttgagacggtggtgaagcaactggctcaatcgaactgcggaacgggcgcg
cgtgtcatcgtcgaaaaacccttcggtcacgatctcgcatcggctcaagcgctgaacaag
gtcttgctcagtgcgttcgaggaaaaagatattttccgcatcgatcattacctcggaaaa
cgtcccgtaaacaacctgctggcattccgcttcgcgaactcctttgttgagtccttttgg
aatcgcaattacatcgaaagcgtgcagatcactatggccgaggattttgggattcagggc
cgcggcagcttttacgacctgacaggaacgatccgcgacgtggttcagaaccacctattt
caggtgctgtcgaacctggcgatggagcctcccgttcggttggacagcgatagcatccgc
aatgagaaggtcaaagtattgcaggctattgctcccatctcctcgcaggatttggttcgt
ggccagttccgtggataccttgaagaacagggtgttgcgaagggctcgcaaaccgaaacc
ttcgctgcgctccggcttgaaatcaactcatggcgctggaagggggttccgttttatatc
cgagcgggcaagtgcctgcccgtaacctccactgaagttgtcgtcagatttaataaacca
ccgtcggtcattgccgatggctcttcgattgaaaaccaccttcgcttccggctcagtccc
gaagtcaccattgcgatgggaatgatgtcgttggcaccaggcgccgagggtcttgtcttg
caaccggccgagatgatcgccagccgttcgccacatgccgatgaaatggacgcatacgaa
cgcgtgcttggagccgccatggctggagacagttcgttcttcgctcgtcaggactacgtg
gaagaggcgtggcgcattgtggaacccgtcctgaaggaaggcaccccggtgcacacctat
gaatgcggaacctggggtcccagtgaagtgaaccaagtcactccaccgggaggctggagc
gatccggcagcccgtgaaaaactggtttaa

DBGET integrated database retrieval system