KEGG   Terriglobus saanensis: AciPR4_2716Help
Entry
AciPR4_2716       CDS       T01408                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00625  Chloroalkane and chloroalkene degradation
tsa00680  Methane metabolism
tsa01100  Metabolic pathways
tsa01120  Microbial metabolism in diverse environments
tsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    AciPR4_2716
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AciPR4_2716
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AciPR4_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C GIDA HI0933_like MvaI_BcnI FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADV83490
UniProt: E8V2L5
Position
complement(3355271..3356461)
Genome map
AA seq 396 aa AA seqDB search
MAENRGVVFLGQNKVEVQSIDFPKMQNPAGKKVGHGVILKVVSTNICGSDQHMVRGRTTA
PTGMVLGHEITGEVIEAGSDVEYIKVGDLVTVPFNVACGRCRTCREQQTGVCLNVNPGRA
GGAYGYVDMGGWIGGQAEFVFVPYADFNLIPFPDKAQAMEKILDLTMLSDILPTGFHGAV
TAGVGVGSTVYVAGAGPVGMAAAASAQILGAAVVLVGDMNTDRLKHVADVGFVPVDLREG
DNLGELIEKILGKPEVDAAIDAVGFEAKAQGKNGQEAPATVLNSLMSVVRAAGGIGIPGL
YVTEDPGAADAAGKTGNLSLRFGLGWAKSHRFYTGQTPVLKYNRQLMQAILHGRIPIAKI
VNATVISLGDAAEGYKAFDSGAAKKFVLDPHGLLGK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaatcgtggagtagttttccttggacagaacaaggtagaagtgcagtcgatt
gatttccccaagatgcagaaccctgcagggaagaaggttgggcacggcgtcattctgaaa
gtggtttcaactaatatttgcggctcggatcagcacatggtgcgtggccgtacgaccgcg
ccgacgggtatggtgcttggacacgagatcacaggagaggtgattgaagcgggctctgat
gtcgagtacatcaaggtaggcgacctggttacagtgccattcaatgtggcctgtgggcga
tgccgcacctgtcgtgagcagcagaccggtgtttgtctgaacgtgaacccaggccgcgcg
ggcggagcctatggctatgtcgatatgggcggttggattggtgggcaggctgagtttgtc
ttcgttccgtatgccgatttcaacctcatcccgtttccggataaggcacaggcgatggag
aagattctggacctcaccatgctgtcagacattctgccgacaggctttcacggagcagtg
acggcgggtgttggcgttggatcgaccgtctacgtcgctggcgcgggtcccgtagggatg
gccgcagcggcttccgcgcagattctcggtgcggcggtcgtgctggtcggtgatatgaat
acggacaggctgaagcatgtggccgatgttggcttcgttcccgtcgatctgcgcgagggc
gacaacctcggagagctgatcgaaaagatcctgggtaagcccgaggtcgatgctgccatt
gatgccgttggttttgaagccaaggcgcagggcaagaatgggcaggaggctccggcgacg
gtactgaactctctgatgtccgttgtccgtgcggcaggtggcatcggcattcctggtctt
tacgttacagaggatccaggagcggcggatgcagcgggcaagacaggaaaccttagtctg
cgcttcggtcttggctgggcgaagtcgcaccgcttctacaccgggcagacgcctgtgttg
aagtacaaccgccagctgatgcaggcgattctgcatggaagaattcccattgcgaagatc
gtcaacgcaacggtgatctccctgggcgacgcggcggaaggttacaaggccttcgactcc
ggcgccgctaagaagttcgtgctcgatccgcatggactgcttggaaagtag

DBGET integrated database retrieval system