KEGG   Terriglobus saanensis: AciPR4_3490Help
Entry
AciPR4_3490       CDS       T01408                                 

Definition
(GenBank) hypothetical protein
  KO
K21349  glucosylglycerate synthase [EC:2.4.1.268]
Organism
tsa  Terriglobus saanensis
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AciPR4_3490
Enzymes [BR:tsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.268  glucosylglycerate synthase
     AciPR4_3490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV84244
UniProt: E8UY10
Position
4218708..4220006
Genome map
AA seq 432 aa AA seqDB search
MASVDMIAETTREAASDETARAEATPPLRILVCLSASAAEPDADHGRQTVAGLMEDVAAR
LRSDRPNSQLMVAFPTYDAEGTEAPETHGYKTVAYAAAGESSTIWMHSAEDFRRAATLMK
QNDCTCCVLLGAEAQSIVPDTISAMIHMVIESGCDLAVPRYLVDPDEGIFNSAMLYPLSR
SLFGSEVRTPLALDIAMSSRMVERMAAATVRIPVGSQASSILWPVAEAAVAGYSMGEVIA
GRREEPVSPDMDLKAALALVAGSLFSDIETKAAYWQRNRPAPLQMCAGEDVRNPGDTLAE
FSMDAHDADPLVDSFRLAYGNLHEIWSLVLPPNSLLGLKKLSIMPMENFRMADALWVRIV
YDFALAHRLRTLNRGHLLGALTPLYLAWVASYILQCRNAEDAKRCMDALAAAFEADKPYL
VSRWRWPDRFNP
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgtggacatgatagcggaaacgactcgcgaagcagcgagtgatgaaacagcg
agggcagaggccacgccgccgctccgcatactggtgtgcctgagtgcttcggcagcggaa
ccggacgccgatcacggaaggcagaccgttgcggggctgatggaagatgtggccgcgcgg
ctgcgatcggacaggccaaactcgcaattgatggtggcttttccaacctatgacgccgag
ggtacagaggcgccggagacccatggatacaagacggtagcctacgccgccgcgggggaa
tccagcacgatctggatgcatagcgcggaagattttcgccgtgccgcaaccctgatgaaa
cagaacgattgcacctgctgcgttctgctgggcgcagaggcgcaatcgattgtgccggac
accatctccgccatgattcacatggtgatcgagtcgggatgcgatctggcggtgccgcgc
tatctcgtcgatcccgatgaaggcatcttcaactccgcgatgctctacccgctctctcgc
tcgctctttggctccgaggtacggacaccgctggcactggatattgcgatgtcctcgcgc
atggtcgaacggatggccgccgcaaccgtgcgtatccccgtgggatcgcaagcgagttcc
atcctgtggcctgtggcggaagccgccgtagcgggctatagcatgggcgaggtcatcgcc
ggacgccgcgaagaacctgtttctcccgatatggatttgaaagccgcgctcgcactggtg
gcaggatcgctcttctccgatatcgaaacgaaggctgcgtactggcagcggaatcggcca
gcgccgttgcagatgtgcgctggagaggatgtgcgcaacccaggcgatactcttgcagag
ttttcgatggatgcgcatgatgcggatccgctggtcgacagctttcgcctggcctacggc
aacctgcacgagatctggtcgctggtgcttcctcccaattcgcttttaggtctcaagaag
ctatcgatcatgccgatggagaacttccgtatggcagacgcgctctgggtgcggattgtg
tatgactttgccctggcgcaccgtttgcgcacgctcaatcgcggccatctgctgggcgcg
ctaacaccgctctacctggcctgggtggcttcgtatatcttgcagtgcagaaacgccgaa
gacgcgaagcgttgcatggatgccctggcagccgcatttgaagcggacaaaccgtacctg
gtctcccgatggcgatggccggaccgcttcaatccatag

DBGET integrated database retrieval system