KEGG   Terriglobus saanensis: AciPR4_3497Help
Entry
AciPR4_3497       CDS       T01408                                 

Definition
(GenBank) amino acid permease-associated region
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
tsa  Terriglobus saanensis
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AciPR4_3497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease Antimicrobial22
Motif
Other DBs
NCBI-ProteinID: ADV84250
UniProt: E8UY16
Position
4225403..4226974
Genome map
AA seq 523 aa AA seqDB search
MLPEGRTLPRQIFATKSIDKLISDSENPEKALRKTLGPVSLTALGIGAVIGSGIFTVIGT
AIGGNPSRIADWKGSPILDLILHHGAVAGRPGAGPALALSLVLVAIVCGLTGLCYAELAS
MIPIAGSAYTYTYATLGELIAWIIGWDLILEYAFSNMSVSVGFAAHIVDLLDWLGIRLDP
KWLSPAFLPLGLQDLAGKDIFGSGWHFGFDIPAFVVVLLLTVVLVRGIRESARTNNIMVL
VKIAAILLFIGFGTSFIHGSNYHPFSPNGFSGVLAGGSIIFFTYIGFDSVSTASEECKNP
RRDVPIGIIATLIVCTILYVGVAAVLTGMVPWQSIAGDGAPVVNALKRVSLLPGAHRLHW
VRLFVLLGALVGMVSSILVFQLGQARVWYAMSRDRLLPDVFSSVHPKFRTPAFATWVAGF
LVAIPSGLFDVGTFAEMSNIGTLFAFVLVSIGVLVLRRKDAGRHRGFRVPFGPVIPVLST
FFCVLLMAGLPAITWVRFFVWLIIGLCVYYFYSRKRSEFYQAK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
attctgccggagggccggacgctgcctagacagatctttgccacgaagtcgatcgacaaa
ctgatctcggattccgagaatcctgagaaggcgttgcggaagacgctcggcccggtttcg
ctgaccgcgctgggcatcggtgcggtcatcggctctggcatcttcaccgtcatcggcacg
gccatcggcgggaacccgtcgcgcattgcggactggaagggctctccgatcctcgatctg
atcctgcaccacggcgctgtggcagggcgaccgggggcgggccctgcgctggccttgtcg
ctggtgctggtggccatcgtctgcggtctgacggggctctgttatgcggaactcgccagc
atgatccccatcgcgggctcggcctacacctacacctatgccacgctgggcgagctgatc
gcctggattatcggctgggacctgatcctggagtacgccttttccaatatgagcgtctcc
gtgggattcgcggcacacattgtggacctgctcgactggctcggtatacggctcgatccg
aagtggctttcgcccgcattccttcccctcggcctgcaggatctggctggaaaagacatc
ttcggctccggctggcactttggcttcgatattcccgcgttcgtcgtcgtgcttctgctt
acggtggtgctggtgcgcggtatccgcgaatccgcgcggacgaacaatatcatggtactg
gtgaagatcgcggccatcctgctcttcatcggcttcggcacaagcttcattcacggatcg
aactaccacccattttcgccgaacggcttctccggtgtgctggcgggcggttcgatcatc
ttcttcacctacatcggcttcgactcggtctccacggcgagtgaggagtgcaagaatcct
cgccgagacgtgcccatcggcatcatcgccacgctgatcgtctgcaccatcctctacgtg
ggcgtagcggccgttctgacgggcatggtgccttggcagagcatcgcgggcgatggcgca
ccggtggtgaacgcgttgaagcgcgtcagccttctgcccggagcgcaccgcctgcactgg
gtacgacttttcgttctgctgggcgcgctggtgggcatggtctcgtccatcctggtcttc
caactgggccaggcgcgcgtctggtatgccatgagccgtgaccggctgcttccggatgtc
ttctccagcgtgcatccgaagttccggacaccggcgtttgctacctgggttgcggggttt
ctggtggcgattccctcggggctcttcgacgtgggcacctttgccgagatgtcgaacatc
ggaacgctcttcgccttcgttctggtttcgattggcgtgctcgtgctgagacggaaagac
gctggcaggcatcgtggtttccgtgtgccttttggcccggtgattcccgtactgagcacc
ttcttctgcgtcctcctgatggccggtctgcccgcgattacgtgggtgcgtttcttcgtc
tggctgatcatcgggctttgcgtttattacttctacagccgcaaacggagcgagttctac
caggccaaatga

DBGET integrated database retrieval system