KEGG   Terriglobus saanensis: AciPR4_3501Help
Entry
AciPR4_3501       CDS       T01408                                 

Definition
(GenBank) hypothetical protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4252
Motif
Other DBs
NCBI-ProteinID: ADV84254
UniProt: E8UY20
Position
complement(4228604..4229179)
Genome map
AA seq 191 aa AA seqDB search
MSISLSPNMFGSLLRRSALGLAPLLLAGTLLAQPPGEMQHFGFDALVQQPATQSSFTFDR
TMLQAADGFFNGADAETRRVVAGLNSITVHNYNFREQANYDPGAFASVAEGFHGAGWKHL
VNANGHPGQATDLWIHFEGANIRNVIVLNRGGRNMNYIAVDCTLRPLDLLHLSGHFGIPK
VDQSAVMVPAK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatatccctgtctccaaatatgtttggttctctcctgcgccgatccgcgcttggc
ctggctcctcttcttttggctgggacacttcttgcccagccaccgggagagatgcagcac
ttcggcttcgacgccctggtgcagcaacccgcaacgcagagctccttcaccttcgaccgc
accatgctgcaggcggcagacggcttcttcaacggcgctgatgccgagacgcgccgcgtc
gtggctggcctgaacagcatcacggtgcataactacaacttccgcgagcaggccaactac
gatcccggcgccttcgcctccgtcgccgaaggcttccacggtgcgggctggaagcatctg
gtaaacgccaacgggcatcccggacaggctaccgatctctggattcactttgaaggcgcg
aatatccgcaacgtgatcgttctgaaccgtggtggacgcaacatgaactatattgccgtg
gactgcaccctgcgtcctctggacctgcttcacctcagcggccacttcggcatccccaag
gtcgatcagagcgccgtcatggtgcctgcgaagtag

DBGET integrated database retrieval system