KEGG   Terriglobus saanensis: AciPR4_3504Help
Entry
AciPR4_3504       CDS       T01408                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
tsa  Terriglobus saanensis
Pathway
tsa02024  Quorum sensing
Module
tsa_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AciPR4_3504
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tsa02000]
    AciPR4_3504
Transporters [BR:tsa02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    AciPR4_3504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_29 SMC_N AAA_22 AAA_16 AIG1
Motif
Other DBs
NCBI-ProteinID: ADV84257
UniProt: E8UY23
Position
4230670..4231503
Genome map
AA seq 277 aa AA seqDB search
MSEPLHDVLLDVRDLTVRFRTEKGAHTAVDGISFQIAAGEVLGLVGESGSGKSATSLAIL
RLLAPNAEIGGSIRFAAGDLLQLPESAMRSRRGREIAMIFQEPMTALNPVMAVGEQIAEA
VRAHHRSLKRDEIKQQVLRAMHDVALPDPERRYGEYPHQFSGGQRQRILIAMAIVNKPKL
LIADEPTTALDVTVQAQILALLADLRRSHGLAMLFISHDLAVTAQTANRVAVMQRGAIVE
MASTREIFHNPQHAYTRSLLAAAPTMRTDRTLPLATV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaccgctacacgacgtgcttttagacgtacgcgacctgacggtgcgctttcgc
acggaaaaaggcgcgcacaccgccgtggacggcatcagctttcagatcgcggcgggggag
gttcttggtctggtcggcgaatcgggttcgggaaagtcggcgacctccctggcgatcctt
cgcctgctcgcgcccaacgccgaaatcggcggcagcatccgctttgcggcgggagacctt
ctccaacttcccgaatccgcgatgcgctcccggcgcggacgcgagatcgcgatgatcttc
caggaaccgatgaccgcgctcaatcccgtgatggccgtgggcgaacagatcgccgaagcc
gtccgggcgcaccatcgcagcctgaagcgcgacgagataaagcagcaggtgctccgcgcg
atgcacgacgtggcccttcccgacccggagcggcgctatggcgagtatccccaccagttt
tccggtgggcagcggcagagaatcctgatcgccatggccatcgtgaacaaaccgaaactc
ctcatcgccgacgaaccgacgaccgccctggacgtgaccgtgcaggcgcagattctggcc
cttctcgccgatttacgccgttcgcatggcctggctatgttatttatctcgcacgactta
gcggtcacagcacagactgcgaaccgtgtggccgtgatgcagcgaggcgcgattgtggag
atggcctcgacgcgggagatctttcacaatccccaacacgcctatacccgcagccttctg
gcggcagctccaaccatgcggacggaccgcactctgccgctcgcgaccgtctaa

DBGET integrated database retrieval system