KEGG   Terriglobus saanensis: AciPR4_3505Help
Entry
AciPR4_3505       CDS       T01408                                 

Definition
(GenBank) metallophosphoesterase
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: ADV84258
UniProt: E8UY24
Position
4231568..4232329
Genome map
AA seq 253 aa AA seqDB search
MRALILSDIHGNLEALEATLAAADRTGPFDAVWNLGDVVGYGGSPNEVVDIIQERATVHV
RGNHDRVCCGLSSALGFNPVARQAAAWTHTVLTEENIKWLAEMPQGPVPCDPFSSVISHG
SPTNEDLYILNIRDAWAPLQQMQRRTTFFGHTHVQGGFSWMEESWTEFRPRYEANSHPAE
WQMTLEKDRHYLINPGSVGQPRDGDWRAAFAILEEEAATVTFHRVPYDLARAQGRILMAD
LPERLALRLREGR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcccttatcctctccgacattcacgggaacctggaagctttggaagcaacgctc
gccgctgcggaccggacaggcccctttgacgcagtctggaacctcggcgacgtagtcggc
tacggcggcagcccgaatgaggtcgtcgacatcatccaggagcgggcgacggtccatgtt
cgtggaaaccatgatcgcgtctgctgcggactctcttcggcgcttggtttcaacccagtg
gcgcgacaagccgcagcctggacccacaccgttctgacggaagaaaacatcaaatggctg
gcggagatgccccagggaccggttccctgtgatccgttctcctcagtgatctcgcacgga
tcgcctacgaacgaagacctttatatcctgaacatacgcgatgcatgggctcccctgcag
cagatgcagcggcgcacgaccttcttcggacacacccacgtgcagggcggtttcagctgg
atggaagagagctggacagagtttcggccgcgctacgaagccaacagccatcccgccgaa
tggcagatgacgctggaaaaagatcgccattacctcatcaaccccggctccgtaggccag
ccccgcgacggcgactggcgcgccgcctttgcgatcctggaagaagaggcggccacggtg
acctttcaccgcgtgccctacgacttggcccgcgctcagggacgcatcctgatggccgac
ctgccggagcggctcgccctgcgcctgcgcgaaggccgctag

DBGET integrated database retrieval system