KEGG   Terriglobus saanensis: AciPR4_3509Help
Entry
AciPR4_3509       CDS       T01408                                 

Definition
(GenBank) Endonuclease/exonuclease/phosphatase
  KO
K07004  uncharacterized protein
Organism
tsa  Terriglobus saanensis
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AciPR4_3509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LTD Exo_endo_phos ASH DUF1573
Motif
Other DBs
NCBI-ProteinID: ADV84262
UniProt: E8UY28
Position
complement(4236108..4239893)
Genome map
AA seq 1261 aa AA seqDB search
MKNFARCLAILLLSFASLASAQTQLVTQPVITQIYGGGSTSNTTGTPYQHDYVELYNPTL
SPISLSGYGIQYGSGSTANWNAFALTPSASIPSGKYYLILFAPASGTFAYNPAKDPVPDQ
IVSIGSNGFTTDLSASNGKVALTYNAGTVTALSATGGNTGTSLTGFTLAGSASCPNPATV
VDFVGYGNQSAACYVTAAAPTIGATNALIRKSPAIATTSNFADFAVGTPNPRNSSYTGVT
TLGITGNSASFVSTQSVTLTATVTYGTATTSATVTADLSSVGGSATQPLFDDGTNGDATA
GDKTYSFKTTITSPAATLSIPVTVVDNTAATASGTIALTVAQPGVAVRIYDIQGAKSSTG
PSPVSVYSSVSTAPTAGVAVQTSGIVTGIGTSGFFLQDPTGDGNPATPDGIYVYSPNAIP
SGLAIGNTVTVTGKITTYPAQTVSHTPATELNLTFATITNTGVSPLPAPVVLTPAMLTPT
GGLYQLTPYEGMRVSIPSLTTTSGTDSASLNESSETYTSNGQFYAVITGTPRPFREPGID
LRDLVVDASKTPAVFDDNPERMLVDSTFFRGTAGSIELSTGAVLPNVTGVLDMTYSNDSF
YDPSRLLLDVSYDKTTVVPGMTVQPVPTAAATQFTVASFNIERFYNPAQATPDNLYYVPA
GVNGYNGSSNTPIVSTGQTFISEAVDVTTAAYARRLQKLSLAVRNVLNLPDVVTLEEVEN
QSVANDIANQINTDAGTPGLYAAYSTDNSTTYTQDGTGISVGFLVKTTTVDKLAVTQFGQ
GHTFTYTGGTQPITLNDRPWLVLNAGVKRGDGIKDYPVTVIVNHMKALTGENSTTSTSTR
QKKELQAEDIAKYIQSLPAGTHVISGGDFNAFEFSDGYTDTLATYTNTNVLPANQVVQPG
VAGLVTPLTDLALLLPADQRWSYVEYGNAQILDHLVVTPDLVAAGAHMAYAHLNADFPTT
AYNDAATPARTSDHDVAVGYFTLPPPNMGAGLTTTTPPSFGSVAIGSTSTQGFVLTNTGE
APLGFISATATGDFGVTNNCGTSLAVGSTCNIAVTFQPTLPGTRTGLLTVVFSGGRIAAT
LIGVGVADFTVTDSAGKNPTSASVTAGTATTVGLTFTSLNSFSGTIALSCTAVNSVFAPG
LTCNVPATFTLAAGATSTQTVTLTANPRTLPSRASGLPTETLLGGMLSGIVLLMAGRLRK
MRLASVLGMLLIGLAAMSAATGCSDSSNLNPAGTPAGTFTYAVTATSGTLSHTETITITV
Q
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaacttcgctcgctgcctggccatccttttgctttcctttgcttcgctcgcctct
gcgcagacgcaattggtgacgcaaccggtgattacccaaatttatggtggtggcagtacc
tcaaatacgacggggacaccttatcagcacgattacgtcgagttatataaccccactttg
agcccaatttccttgagcggatatggaattcagtacggtagcggctcgaccgcaaactgg
aatgcgtttgctcttacaccctccgcttcaattccttcgggtaagtactatctcattctg
tttgcaccggccagcggaacattcgcgtataaccctgccaaggatccggtgcccgaccag
atcgtttcgattggttcgaacggctttactacggacttgagcgcttcgaacggcaaagtg
gcgctaacttacaacgccggtacggtgacggcgctttcggctacaggtggcaatacggga
acttcccttactggttttacgctcgcgggatccgcatcctgtccgaatccggcgacggta
gtggattttgtcggatacggaaatcagtcggctgcctgctatgtgacggcggccgcaccg
acgatcggcgcgacaaacgcactcattcgtaaaagccctgccatagccacgacgagcaat
tttgcagatttcgccgtgggtacgccgaatccaagaaactctagttacacgggcgtaaca
acgctcggcatcacaggcaactccgcttcgtttgtctccactcagagcgtgacgctcacc
gcgacggtgacctatggcaccgcgacgacgagcgccacggtgaccgccgatctttccagc
gtgggaggatccgcaacgcagccgctctttgacgacgggaccaacggcgatgccaccgcc
ggcgacaagacgtattcgttcaagacgacgatcaccagccccgccgcgaccctgagtatt
cccgtgacggtcgtggacaacaccgcggccaccgcttcgggcacgattgcgctgacggtc
gcacagcccggtgtcgcggtacgcatctatgacattcagggagcgaagtcttcgaccggg
cccagccccgtgtcggtgtactccagcgtctccaccgctcccaccgctggtgtagcggtg
cagacgagcggcatcgtgacaggcattggaaccagcggcttctttctccaggacccgacg
ggcgatggcaatcccgcgacgccggatggaatctatgtctactcacccaatgcgatcccg
agtgggctggccattgggaacaccgtcactgtgaccggaaagatcactacctatccagcc
cagaccgtgagccatacaccggcgacggagctcaacctgacctttgccacgatcacgaac
acgggcgtctccccgttgcccgcaccggtggtcctgacgcctgccatgctgacgccgacc
ggcggtctctatcagctgacaccctacgaaggcatgcgcgtctccattccgtcgttgacc
acgacctctggcacagattcggccagtctgaatgaatcctccgaaacgtatacctccaac
gggcagttctatgccgtgatcacgggaaccccgcgccccttccgcgaacccggcatcgac
ctccgcgatctggtggtggacgcgtcgaagactcctgcggttttcgatgacaatccggag
cgcatgctggtggactccaccttcttccgcggaacggcgggatcgattgagctttctacc
ggcgccgtgctgcccaatgtcacgggcgtgctcgatatgacctactccaacgattcgttc
tacgatccctcgcgccttctgctggacgtgagctacgacaagacgaccgtggtgccgggc
atgaccgtgcagcctgtaccaacggctgcggccactcagttcacggtcgcctcgttcaat
atcgaacgcttctataacccggcgcaggcgaccccggacaatctttactacgtgcccgct
ggcgtgaacggatacaacggaagctcgaatacgccgattgtctcaaccggacagaccttt
atctcggaagcggtcgatgtgaccacggcggcgtatgctcgccgtttgcagaagctttcg
ctcgccgttcgtaacgtcctgaatctgcccgacgttgtgacactggaagaggtggagaac
cagagcgtagcgaacgacatcgccaaccagatcaatacggacgcaggcacgcccggcctc
tatgcggcgtacagcacggacaactccaccacgtacacgcaggatggaacgggcatctct
gtcggcttcctggtgaagacgacgaccgtggacaagctggcggtcacgcagttcggtcag
ggacataccttcacctacaccggcggaacgcagccgatcacgctgaacgatcgcccctgg
ctggtcctgaacgcgggcgtcaagcgtggcgacggcatcaaggactacccggtgaccgtg
atcgtgaatcacatgaaagcattgacgggcgagaacagcaccacctcgacctccacgcgg
cagaagaaggagctgcaggcggaagatatcgccaagtacatccagtcgcttcccgccggg
acgcatgtgatctccggtggagacttcaatgccttcgagttctccgacggttacacagat
acccttgcgacgtacacgaacacgaacgttttgcccgcaaaccaggtagtgcagccgggc
gtcgccggtctggtgacgccgcttacggacctcgcgcttctgctgccagccgatcagcgc
tggtcttacgtggaatacggcaatgcgcagatcctcgaccacctcgtagtgacgccggac
ctcgtggccgcaggcgcacatatggcctacgcccacttgaacgccgatttccccacgacg
gcttacaacgatgccgccacacccgcacgcacttcggatcacgacgttgccgttggttat
ttcaccctgccgcctccgaatatgggagcagggctcacaactacaacgcctccgtccttt
ggaagcgtagcgatcggctctaccagtacgcagggatttgtcctgacgaacaccggcgaa
gcaccgctaggcttcatcagcgcgacggctacgggtgactttggcgtgacgaataactgc
ggaacctcgcttgccgtcggctcgacctgcaacatcgccgtgaccttccaaccgacgctc
cccggcacgcgtaccggtctgctcacggtagtgttttcgggagggaggatagccgcaacg
ctcataggcgttggcgtggcggactttacggtgacagactccgcagggaagaatccgacg
tctgcaagcgtaacggcaggcacggctactacggttgggctgacgttcacttcgctcaac
tcgttctccgggacgattgccctcagttgcaccgctgtcaacagcgtcttcgcacccggc
ctcacgtgcaacgttccagcaaccttcactctggctgcaggcgctaccagcacgcagacg
gtgacgctcacagcgaacccgcgtacgctgccatcacgtgcttccggtctgcccacggaa
acactgctcggtggcatgctgagcggaattgtcctgctgatggcgggccgtctacgcaaa
atgcggctggcgagcgttcttggcatgctgctgatcggtctggccgcgatgtccgccgca
acgggttgcagcgattcttcaaacctcaacccggcgggaacgcccgcaggcacgttcacc
tacgccgtgacggcgacgagcggaacgctctcgcatacggagacgatcaccatcaccgtg
cagtaa

DBGET integrated database retrieval system