KEGG   Terriglobus saanensis: AciPR4_3511Help
Entry
AciPR4_3511       CDS       T01408                                 

Definition
(GenBank) Beta-glucuronidase
  KO
K01195  beta-glucuronidase [EC:3.2.1.31]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00040  Pentose and glucuronate interconversions
tsa00860  Porphyrin and chlorophyll metabolism
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AciPR4_3511
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AciPR4_3511
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     AciPR4_3511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: ADV84264
UniProt: E8UY30
Position
4241190..4243064
Genome map
AA seq 624 aa AA seqDB search
MTLCTKISGKKLRILHKGLLSLACAVSLPLFAQQPMKTLLVGVDHRAVTSLNGDWHYLVD
QPPAKGLYTSDGRVRENGYALNTHPNISSGPHNEEYDFSTAPTLKVPGDWNTQEPTLFRF
EGVVWYQRNFDFQPKPNTRTFLHVGAANYKSFVWVNQKHICDHEGGFTPYDCDLTTALKP
GNNFVVIAVDSTRQVDGIPSVSIDWFNYGGLTRDVSLVTVPTHFIDDYDVHLKHDATFSP
SANVLSGYVHVEGAAVGTPVALHIPEAGVDTTVETDAEGRAAFEVKAKSLSLWSPETPKL
YKVQISSGQDAITDDIGFRDIRVDGTRILLNGKAIFLQGANMHAEAPYRGGSVHSDEDVK
NIFGFLKDMNANFVRLCHYPHDERMERMADRNGVMIWSEIPLWQRISYDKPEVYAKATFM
LNEMIRRDRNKASVILWSVSNETPNNPTRTKFLTNLANEARRLDPTRPITSALIGPKVDQ
DAVLQNDPLADALDVVGQNQYIGWYEGRPEDADKKTWTLPQKPILMSEFGAEATQGNHGG
PNQRWTEEQQLNVFQHQFVMMRKIPQVRGLIPWVLMDFRSPTRNIPKLQEGYNRKGLLSE
DGKKKLAFDLFQKTYKEHTVGKAE
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgacactttgcacgaaaatttcaggaaaaaaactccggatcttgcataaaggactactt
tctctcgcctgcgccgtttctcttccgctttttgcgcagcaacccatgaagacgcttctc
gtcggcgtcgatcaccgggcggtgacttccctcaatggcgactggcactatctcgtcgac
cagccgcctgccaagggcctttacaccagcgatggcagggtgcgggagaacggatacgcg
ctgaacacccatcccaacatcagcagcggaccgcacaacgaagagtacgacttctccaca
gcgccgacgctgaaggtccccggcgactggaacacccaggaaccgaccctcttccgcttc
gaaggtgtcgtctggtatcagcgcaacttcgatttccagcccaagccgaacacgcgcacc
tttctgcatgttggcgcggcgaactacaagtccttcgtctgggtgaatcagaaacatatc
tgcgatcacgaaggcggcttcacgccgtacgactgcgacctcaccaccgcgctcaagccc
ggcaataacttcgtcgtcatcgccgtcgattcgacgcgtcaggtggacggcatcccgtcg
gtcagcatcgactggttcaactacggcggactcacgcgcgacgtctccctggtcacggtg
ccgacccactttatcgacgactacgacgtccatctcaagcacgacgctaccttctctccg
tcggcgaacgtgctcagcggctatgtccacgtagaaggagctgcagtcgggacgccggtg
gcgctccatatccctgaagcaggggtcgacaccacggtggagaccgatgccgagggtcgc
gctgcttttgaggtcaaagccaaaagcctgagcctctggtcgcctgagacgccaaagctc
tataaagtgcagatctcctcaggccaggacgccatcacagacgacataggcttccgcgat
attcgtgtcgatggcacgcgcattcttctgaacgggaaggccatctttctgcagggcgcg
aacatgcacgcagaagcgccctatcgaggaggcagcgttcactcggacgaagacgtgaag
aacatcttcggcttccttaaagacatgaacgcaaacttcgttcgcctctgccactatccc
cacgatgaacgcatggagcgcatggccgatcgcaacggcgtgatgatctggtcggagatt
ccgctctggcagcgcatctcctatgacaagcctgaggtttacgcaaaggccaccttcatg
ctgaacgagatgatccgccgcgatcgcaataaggcttcggtcattctctggtcggtttcc
aatgagacaccaaacaatcccacacgcacgaagttcctgaccaacctcgccaacgaggcg
cgcaggctcgatccgacgcgtccgatcacctcggcgctgatcggaccgaaggtggatcag
gatgccgtcctgcagaacgatcctttggcggatgcgctcgatgtcgtaggccaaaaccag
tacatcggctggtatgaaggtcgtccggaagacgcggacaagaagacctggaccctgccg
cagaagccgattctcatgtcagagtttggagcggaagccacgcagggaaaccacggcgga
ccgaaccagcgctggacagaagaacagcaactcaacgtcttccagcatcagttcgtcatg
atgcggaagatcccccaggtgcgcggtctgattccatgggtcctgatggatttccgttcg
cccacacgcaatatccccaagctacaggagggctacaaccgcaagggtctgctctccgaa
gatggaaagaagaagctggccttcgatctttttcagaagacgtacaaagagcacaccgtc
ggcaaagcagagtaa

DBGET integrated database retrieval system