KEGG   Terriglobus saanensis: AciPR4_3514Help
Entry
AciPR4_3514       CDS       T01408                                 

Definition
(GenBank) lipopolysaccharide biosynthesis protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzz GNVR LapA_dom SlyX
Motif
Other DBs
NCBI-ProteinID: ADV84267
UniProt: E8UY33
Position
4249498..4250679
Genome map
AA seq 393 aa AA seqDB search
MSTNDAQSGEYLPQPEIQTGEEGFDLLQLGLIFLKHLRLVLFCTLAMGIGAYVVTLFIHR
AYGAHATFLLESQDSANGLTGNLFFSRPTDPTISLLQSESVSELLVSGQHLEPLFPNMTP
RAIQRQAAGEATFARSADGMFIISVTDVKPERAVAIANGYLQALQELNDRMNLDAAKHRR
TFYESQVDEERDALEKAELRLTELQQKTGVVQPESQTSMELSTIASLKAQITAQQVALST
LLTGATEQNPEVIRMRTEIDALSAQERRMEASFNGKQTNDIPATNLEYQHRLADVTYHRT
LLTSFSSEFQQARLQSTYQSPHVRVVDMAHLPLPITWPPSMKITLIFVAIGFFLGILLAG
MRHMAERLMVDPERRLQVEEMKHSLRRALFLRS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgaacgacgctcaatccggtgaatacttgcctcagccagagatccagactggc
gaggaagggttcgatcttcttcagttaggccttatttttctcaagcacctccgcctcgtt
ttgttctgcactcttgccatggggattggtgcgtacgttgtgaccttgttcattcacagg
gcctatggagcacacgcgacatttctgcttgaatcacaggactctgcaaacggtttgacc
ggaaatctcttcttcagcagaccgaccgacccaaccatctctcttctgcagagcgagtcg
gtgtcggagctccttgtaagcggacagcatcttgaaccgctctttcctaacatgacgcca
cgggccattcagagacaagctgccggagaggccacctttgcccgctctgcggacggcatg
ttcattatttcggtcaccgacgtgaaaccggaacgggccgtcgccatcgcgaatggttac
ctgcaggccttgcaggagctgaatgaccgcatgaacctcgatgcagccaagcatcgtcgc
actttttacgagagccaggtcgacgaagaacgtgacgccctggaaaaggcagaacttcga
ctgacagaacttcagcagaagaccggcgtcgtacagcccgaaagccagacttccatggag
ctttccacgatcgcgagcttgaaagcgcagattacggctcagcaggtggccctttcgacg
cttctcactggcgcaaccgaacagaatccggaagtcattcgaatgcgaacggagatcgac
gcgctttcagcgcaagagcgtcgcatggaagcaagtttcaacggcaagcagaccaacgat
atcccggcaacgaaccttgaatatcagcatcggttggcggacgtcacgtatcaccgcact
ctgctgacctccttttcctcagaattccagcaggcccgcctgcagtcgacctaccagtcg
ccccacgtccgcgtcgtcgatatggcccaccttcccctgccgattacgtggccaccaagc
atgaagatcactttgatcttcgtcgccatcggattttttcttggcatcctgctcgctgga
atgcgccatatggctgaacgcctcatggttgacccggagcgtcgccttcaggtggaagag
atgaagcactctcttcgcagggccctcttccttcggagctag

DBGET integrated database retrieval system