KEGG   Terriglobus saanensis: AciPR4_3515Help
Entry
AciPR4_3515       CDS       T01408                                 

Definition
(GenBank) hypothetical protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV84268
UniProt: E8UY34
Position
4250680..4252002
Genome map
AA seq 440 aa AA seqDB search
MASTSLTLERPAGHHRTIQVIAALLCVFIVLVPKGGIKAIGLPITWGYLLLIFSFIYSLP
TRLLTYRMFYSRRLLITLATIVSFLIPFFYSTWANGIASLPFFVSTFTNFVVLPFLFFIF
YPPFLPQLDGPRFRKVLVFCILGAAIYGIFTFLLRPITGKYVEIPFLTTNSGDANLEATK
NIARGNTFKLISTYNNGNIYGVCTFILLPLFDRLVSQRWKRLTVRAAIFLTLSRSVWAGL
FFEQILSMAAVFVEQARSFPRIHGKALLSRLLLLSACGVVLSVIVVWMNRDSSFIFDSEL
GGRANSLSTFSYATFLPSVPVDAFFEILYASAVYQYGYLGLLAIIAVFFGPWIVLLSDLR
ALSDPYRRAAMKGLVLYSLLSFGDCAISFIPVMTFYWFAYMVFLFGFPGHLVVSSTRVKT
RSSTFLNPTPARISPVGGLT
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcatccacgagccttactcttgaacggcccgcgggccaccaccgcacgatacaggtg
atcgcggccctcctctgtgtttttatcgtcctcgtacccaagggcggcatcaaggccatc
ggactccccattacctggggatatcttcttctcatcttcagttttatctatagtcttcct
acccgtttacttacttacagaatgttctattcgcggcgactgctgattacacttgccacg
attgtttcttttttgatccctttcttctattccacctgggcaaacgggattgccagtctt
ccgttcttcgtcagcacgtttacgaactttgtcgttcttcccttcctctttttcatcttc
tatcccccttttctgcctcagttggacggccctcgttttagaaaggtcctcgtcttctgc
attctcggcgctgcgatttacggcatcttcaccttcctgcttcgacctattacaggaaaa
tatgtggagattccttttctcacgacgaactccggcgatgccaatctggaagccaccaag
aacatcgcccgtggaaataccttcaagctcatctccacgtacaacaacggaaatatctat
ggcgtctgtaccttcatcctgcttcctctttttgatcggctggtgtcccagagatggaag
cgcctgacggtacgtgccgccatcttcctgacgctttcgcgctctgtctgggcgggactc
ttctttgaacagatcctctccatggccgcagtcttcgtggaacaggcgcgttctttcccg
cgtatccacggtaaagctttgttgagccgcctcctcctgctttctgcctgcggagttgtc
ctctccgtgatcgtcgtctggatgaaccgcgactcttcgttcatctttgacagcgagttg
ggtggtcgcgcaaattctctttcgaccttctcctacgccaccttccttccttcggtgccc
gtcgatgctttctttgagattctctacgcgtccgccgtctatcaatacggctatctcggc
ttgctcgcgatcatcgcggtctttttcggaccgtggatcgttctgctctccgaccttcgg
gcgctttccgacccctaccgacgcgcagcgatgaaaggtctcgtcctctactctctgctc
tcctttggcgactgcgccatcagttttattccggtcatgaccttttactggttcgcctac
atggtcttcctcttcggttttccaggtcatctggttgtttccagtacgagagtaaagaca
cgctcttcgacctttctaaatcccacacctgctcgcatctctcccgtgggcggtcttacc
tga

DBGET integrated database retrieval system