KEGG   Terriglobus saanensis: AciPR4_3517Help
Entry
AciPR4_3517       CDS       T01408                                 

Definition
(GenBank) FkbH like protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIF
Motif
Other DBs
NCBI-ProteinID: ADV84270
UniProt: E8UYQ4
Position
4252454..4254325
Genome map
AA seq 623 aa AA seqDB search
MAHTSFNPECLLQWLPTAPADWSARLSEAQQTADPWLHLQALANFRLDFLANAKLDRALT
KTVATHSIPASFISLRLGLLASSTTRHLLPSMRVAALRRGIVLEIYEGGYGQYMQELADP
LSGLRSFNPQALLFAFDEHHIVELAQQGEPMDRVRLAWKLAREHTSAALFHQTMLPVFPR
LLGSNEHRLSTSPESILQRFNLELTTEADREGAALLDVTAPSAQDGLTIWHDPALWHRAK
QIINPAAAPLYAEALAPLLAAHLGRSRKCLVLDLDNTLWGGVIGDDGVEGIQLGHGHAEG
EAFLAFHQFCLRLRDRGILLAVCSKNEEAAALPPFSQHPETLLRREHFAAFYANWQDKPT
NLRTIAHHLNIGLDSLVFVDDNPFERALVRRELPEVAVPELPEDPALFAATIARAGYFES
LGLTPEDLERARHYQANQSREDLRCSVTDLDGYLRSLQMELRYRPFDEANLQRIAQLTQK
TNQFNVTTRRHTAEELRVMMQDPCTVTLQFQLRDSFGDNGTIALLIAFVRETSLVIDTWL
MSCRVLGRRVEDAVLRLLVEEAKQRQLDLIEGEFRPTAKNTPVENLFPRLGFTPEVSTSE
AQWFSLDVGAYSPAEIPMLITHE
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcacacctccttcaatccggaatgtcttctgcaatggctgcccaccgctccagca
gactggtctgcgcgcctctctgaggcacaacagaccgcagatccctggctacacctgcag
gccctggcgaacttccgcctggactttcttgcaaacgcgaagctggatcgcgctctcaca
aagaccgtcgccactcattcaatcccagccagctttatttctcttcgactcggcctgctc
gcgtcgtccacgacgcgccaccttttgcccagcatgcgggtcgcggcgcttcggcgaggc
atcgtgcttgagatctatgaaggcggatacgggcagtacatgcaggagcttgccgatccg
ctttcaggactgcgcagcttcaatccgcaggctctgctcttcgcatttgacgaacaccat
atagtcgaactcgcacaacagggcgagcccatggatcgtgtgcgcctcgcgtggaagctc
gcgcgcgagcatacctcggcggcactctttcaccagaccatgcttcccgtcttcccgcgt
ctgctcggttcgaacgagcatcgtctttcaacgtctccggagagcatcctccagcgtttc
aacttagaactgaccacagaggccgaccgcgaaggcgctgctctgctcgacgtgaccgca
ccgtccgcacaggatggtctcaccatctggcacgaccccgctctatggcatcgagccaag
cagatcatcaatcccgctgctgcccccttgtacgcagaggcccttgcaccgttactcgcc
gcgcacctcggaaggtctcgcaaatgcctcgttctcgatctcgacaataccctctggggt
ggcgtcatcggcgacgacggcgtggaaggcattcagcttggccacgggcatgccgaaggc
gaagcgtttcttgcgttccaccagttctgcctgcgcctgcgcgatcgcggcatcctgctc
gccgtctgctccaagaatgaggaagctgccgcccttcctcccttctcgcaacatcctgag
accttgctgcggcgcgagcattttgccgcgttctacgctaactggcaggacaaacctacc
aatctgcgaaccatcgctcaccacctgaacattggtttggactctttggtctttgtggat
gacaaccccttcgagcgcgctcttgttcgccgcgaacttccggaggtcgccgtcccggag
ttgcccgaagatcccgcgctgttcgcggccaccatcgcacgcgcaggatacttcgaatcc
ctcggactcactccggaagacctcgaacgcgcacgccactatcaggcgaatcagtcccgc
gaagatctccgctgttctgtcaccgatctcgatggatacctgcgctcactacagatggag
ctgcgctatcgtcccttcgacgaagccaatctccagcgcattgcgcaactcacgcagaag
accaaccagttcaatgtcaccacgcggcgtcataccgctgaagagcttcgcgtcatgatg
caggatccctgtacggtgactttgcagtttcaattgagggacagctttggagacaacggc
accatcgccctcctcatcgccttcgttcgtgagacgagtctcgtgatcgatacatggctg
atgagctgccgcgtactgggcaggcgggtggaggatgccgtgcttcgcctcctcgtggag
gaagcaaaacaacgtcagctcgacctcattgagggagagtttcggcccacagcgaaaaac
acccccgttgagaacctcttcccccgtctaggcttcacaccggaagtctccacttccgaa
gcccaatggttttctctcgatgtcggagcatactcacccgcagagattcccatgctcatc
acccatgagtag

DBGET integrated database retrieval system