KEGG   Terriglobus saanensis: AciPR4_3519Help
Entry
AciPR4_3519       CDS       T01408                                 

Definition
(GenBank) glycosyl transferase family 9
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_9
Motif
Other DBs
NCBI-ProteinID: ADV84272
UniProt: E8UYQ6
Position
4254574..4255623
Genome map
AA seq 349 aa AA seqDB search
MPRSLIVKLGAIGDVIMTLPAAFALHESGHEIHWICGRGVLPILELYPWVHPIPVDERAL
LQSSLIQRLQTMIGLWRKLGLSHYDTIATIYYDRRYQTLTLPVRARRKILLRQGDRALDL
LPNRHHTDEYARLLVGEDAGPVPDSLAPIFPANLPPSPLPPPQRMRIVLAPAGAKNLLRD
DALRRWPAESYVSLAGIALEAGYEVVLAGGPDDVWIRPYFEHLPVIDLIAQLSLPQLLAL
FDASAAVVTHDTGPLHLAGITKTRLLGIFGPISPWERLPRRPGTAAIWGGEGFACRPCYV
AGNFAACTNNLCIQQVTPAMAFQQLQVLLEGEPASPFVVVPQPPPGAFV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcagtttaatcgttaaactcggtgccattggcgacgtcatcatgacgttgcct
gcggcctttgctttgcacgaaagcgggcacgagattcactggatctgcgggcgaggcgtt
cttcctattctggaactctatccgtgggtgcatcccattccggtcgacgagcgtgcgctt
ctgcaatccagcctgatccaacgcttgcaaacgatgatcggtctctggcgaaagcttggc
ctttcccactacgacacgattgccacgatctactatgaccggcgttaccagacgctcaca
cttcctgtgcgtgcgcggcggaagattcttctgcggcagggcgaccgagcattggacctg
cttcccaatcgccatcacaccgacgagtacgcgcggcttcttgtaggagaagatgcgggc
ccggtgcctgactcgctggcccccatcttccctgccaatctgcctccgtctccgcttccg
ccccctcagagaatgcgcatcgtgctggcaccggctggcgcaaaaaatcttctgagagat
gacgcgctgcgccgctggcctgcggagagctatgtctcgctcgccgggatagcgttggag
gctggttatgaagtcgtgctcgcgggcggcccggacgacgtctggattcgaccctatttt
gagcaccttccggtcatcgatctcatcgcgcagctctcgcttcctcaacttctcgccctc
ttcgacgcctccgcggcagtggtcacccacgataccggcccacttcatcttgcaggcatc
acaaagacaagacttctcgggatctttggcccaatctctccctgggagcggcttccgcgc
cgccccggcactgcggccatctggggaggcgaaggctttgcctgccgcccctgttacgtg
gcgggaaacttcgcagcgtgcaccaataacctttgtattcagcaggtgactcccgccatg
gccttccagcagcttcaagtgcttcttgagggcgaacctgcttctccgtttgtggtcgtc
ccgcagccccctccaggggccttcgtatga

DBGET integrated database retrieval system