KEGG   Terriglobus saanensis: AciPR4_3525Help
Entry
AciPR4_3525       CDS       T01408                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00970  Aminoacyl-tRNA biosynthesis
tsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AciPR4_3525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tsa03029]
    AciPR4_3525
Enzymes [BR:tsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AciPR4_3525
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AciPR4_3525
Mitochondrial biogenesis [BR:tsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AciPR4_3525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADV84278
UniProt: E8UYR2
Position
4259121..4260569
Genome map
AA seq 482 aa AA seqDB search
MNLKTLTIDVTLAALRSGETTASALAQLHFDKIKTEDQVPGKEINSFLSLAEERAMQQAE
KIDGMLKAGENLPVLAGVPIGIKDVLTMQGAPSTAGSKILKNYHPPYDATAVRKLEAAGA
VLLGKLNCDEFAMGGSNENSAYGPVRNPRALDRVPGGSSGGSAAAVAAGFCVASLGTDTG
GSVRQPAAFCGVTGLLPTYGRISRYGLIAFASSLDRVGPVTRSVRDTATMLSVLSGPDPM
DATASQTPVEDYVAATKAPVAGLKIGIPAEYFGEGLEPEIRAAVERTLDQLKAAGCTTHP
ISLAHTKYAVPTYYVLATAEASSNLSRFDGVRFGHRVDHPKNLSELYKESREEGFGPEVK
RRILLGTYSLSSGYYDAYYRKAQQVRTLLARDFLAAFAEVDAIVTPITPTPPWKLGEKTE
DPLSMYLADIYTVAASLAGISGISVPVGETAEHLPIGVQVLAGHFQEAKLLRVAQAIEDA
KK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcaagaccctgaccatcgacgtcaccctcgccgcgctccgttccggcgaaacg
accgccagcgccttagcccaacttcattttgacaagatcaaaaccgaagaccaagtcccg
gggaaggaaatcaactcctttctctcccttgccgaagagcgcgcgatgcagcaggcggag
aagatcgacggcatgctgaaggcgggcgaaaacctccccgtcctggcgggcgtccccatc
ggcatcaaggatgttctgacgatgcagggtgcgccctctacggcaggctccaagatcctc
aaaaactaccatccgccctacgacgccacggcggtgcgcaagctggaagccgcgggagcg
gtccttctgggcaagctgaactgcgacgagtttgccatgggcggatcgaatgaaaactcc
gcctacgggccggttcggaatcccagagcgctggaccgcgttcccggaggctcctccggg
ggctctgccgcagccgtcgccgcgggcttctgtgttgcttcgctaggcacggatacgggc
ggctcggtgcgtcagcctgccgcgttctgcggcgtgacgggcctgctgcctacctacgga
cgcatctcgcgttacggcctgatcgcttttgcctcttcgctggaccgcgtcggacctgtg
acacgctccgtgcgcgataccgccaccatgctctctgtcctgagcggcccagatcctatg
gacgccaccgcttcgcaaaccccggtggaggattatgttgccgcgacgaaggcccccgtt
gccggattgaagatcggcattcccgccgagtacttcggcgaaggcctcgagccggagatc
cgtgccgccgtggagcggacgctggaccagcttaaagctgccggatgcactacgcatccg
atttccctggcgcatacaaagtacgccgttccaacgtattacgtcctggcgacagccgag
gcgagcagcaatctgtcgcgttttgacggcgtacgcttcggccatcgcgtcgaccacccg
aagaacctttcggagctctacaaggagtcgcgcgaagagggtttcggaccggaggtcaag
cgccggatccttctgggcacgtactcgctctcctcgggctactacgacgcttactatcgc
aaggcgcagcaggtccgcacgcttctggcgcgggattttctggccgcctttgccgaggtg
gacgccatcgtgactccaatcacccccacgcctccatggaaactcggtgaaaagacagaa
gatccgctctccatgtacctcgcggatatctacacagtcgccgcctcattggccggaatc
agcggcattagcgtgcccgtcggcgaaacggcggaacatctccccattggcgttcaggta
cttgcgggtcacttccaggaggccaagcttcttcgcgtcgctcaggccatcgaggatgct
aaaaaataa

DBGET integrated database retrieval system