KEGG   Terriglobus saanensis: AciPR4_3527Help
Entry
AciPR4_3527       CDS       T01408                                 

Definition
(GenBank) hypothetical protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3482
Motif
Other DBs
NCBI-ProteinID: ADV84280
UniProt: E8UYR4
Position
4261147..4261464
Genome map
AA seq 105 aa AA seqDB search
MRSTRFVSAATLAFALLASTAAHAQNSFRNDGREDRRDNRRDFREQQRFDEQRQREEHFR
FEQSRFNHTDERFEPQRFENRRDFNLAEHRLVHDRYEDHGSNYAR
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcacacgttttgtctcagccgcaacgctcgctttcgcacttcttgcctccact
gccgcccatgcgcagaactccttccggaatgatggacgagaagaccggcgggacaatcgt
cgagatttccgcgaacagcagcgttttgacgaacagcgccagcgggaagagcacttccgc
ttcgagcagtctcgtttcaaccacacggacgaacgctttgagccacagcgcttcgagaac
cgtcgcgatttcaacctggcagagcaccgcctcgtacatgaccgctacgaggatcacgga
agcaactatgcccgctaa

DBGET integrated database retrieval system