KEGG   Terriglobus saanensis: AciPR4_3528Help
Entry
AciPR4_3528       CDS       T01408                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K00322  NAD(P) transhydrogenase [EC:1.6.1.1]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00760  Nicotinate and nicotinamide metabolism
tsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AciPR4_3528
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.1  NAD(P)+ transhydrogenase (Si-specific)
     AciPR4_3528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_2 AlaDh_PNT_C 3HCDH_N Thi4 XdhC_C DAO 2-Hacid_dh_C FAD_binding_3 ApbA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ADV84281
UniProt: E8UYR5
Position
4261638..4263035
Genome map
AA seq 465 aa AA seqDB search
MTTVYDLIVIGSGPSGQRAAIYAAKLGKKVALIEMREVVGGACISTGTIPSKTMREAVLH
LSGYNYKSIYGMNYRVKERITMADLAFRVQHVIKTEIDVTEAQLSRNNIEMLTGTASFVD
ATHLKVTNSRGSTIYESANIVIATGTKPAASVKVPINGTSIINSDLVLDLKTLPKTMIVV
GGGVIGVEFTCMFAALGVRVTLIERRPRLLEFADQEIVEALSYHLRDARVTMRMNEEVES
VEEMEDGSVVANLESKKKIQGDALLFAVGRQGNVDELNLSAIGVESDERGRIPVDKDYRT
KARNVFAVGDVIGFPSLASVSMEQGRVAAARAFGDESILSNPSFYPYGIWTIPEISFLGK
TEEQLTEEDVPYEVGVAYYREIARGQIRGDTTGRLKLIFHRENKSILGVHIIGEGASELL
HVGQAVMALGGNIDYFVDTVFNYPTLAEAYKVAAFNGLNRLSKFE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtatacgacctgatcgttattggctctggcccttccgggcagcgggccgct
atttatgccgctaaactcggtaaaaaagtcgctcttattgaaatgcgcgaagtggtcgga
ggagcctgtatctctaccggcaccatcccttccaagaccatgcgcgaagccgtccttcac
ctctccggttataactacaaatctatctacggtatgaactaccgcgtgaaggaacgcatc
acgatggccgatctggccttccgcgttcagcacgtgatcaagaccgagatcgacgtgacc
gaagcccagctctcgcgcaacaacatcgagatgctcaccggcacggccagttttgtagac
gccacccatctaaaggtaactaactcgcgtggttccaccatttacgagtcggccaacatc
gtgatcgctactggcaccaagcctgcggcttcagtaaaagttccgatcaacggcacctcg
atcatcaactccgacctggtgctggacctcaagacccttccgaagacgatgatcgtcgtc
ggcggaggcgtgatcggcgtcgagttcacctgcatgttcgccgctctaggcgtccgggtc
acgttgattgagcgccgcccacgcctgctggagtttgccgaccaggagatcgtcgaggcc
ttgagctaccaccttcgcgatgcgcgtgtcacgatgcgcatgaacgaggaagtggagtcc
gtggaagagatggaagacggctccgtcgtcgcgaacctggagtccaagaagaagatccag
ggcgatgcccttctgtttgcagtcggtcgccagggaaatgtggatgagctgaacctctcc
gccatcggcgtcgaatctgacgagcgcggtcgtatcccggtcgataaggactaccgcacc
aaggcacgcaatgtcttcgccgtgggcgacgtcatcggcttcccttccctggcctcggtc
agcatggagcagggccgtgtggctgcagcgcgggcctttggagacgagagcatcctctcc
aaccccagcttttacccgtacggcatctggacgatcccagagatcagcttcctcggcaag
accgaagagcagcttacggaagaggatgtgccttacgaggtcggcgtcgcctactaccgc
gagatcgcccgtgggcagattcgtggagatacgacaggccgtttgaagctcattttccat
cgcgagaacaagtcgatcctcggcgtgcacatcattggcgaaggcgccagcgaactgctg
cacgtcggacaggctgtgatggctctgggtggaaacatcgattactttgtggatacggtg
ttcaattacccgacgctggcggaggcttataaggtcgctgcgttcaatggcttgaaccgg
ttgagtaagttcgagtag

DBGET integrated database retrieval system