KEGG   Terriglobus saanensis: AciPR4_3531Help
Entry
AciPR4_3531       CDS       T01408                                 

Definition
(GenBank) helicase c2
  KO
K03722  ATP-dependent DNA helicase DinG [EC:3.6.4.12]
Organism
tsa  Terriglobus saanensis
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tsa03400]
    AciPR4_3531
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AciPR4_3531
DNA repair and recombination proteins [BR:tsa03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    AciPR4_3531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C_2 DEAD ResIII DEAD_2 UvrD-helicase PhoH T2SSE AAA_30 TrwB_AAD_bind Transglut_core3 Glyco_tran_10_N
Motif
Other DBs
NCBI-ProteinID: ADV84284
UniProt: E8UYR8
Position
4266504..4268525
Genome map
AA seq 673 aa AA seqDB search
MPVTLTQTEPLPTLRDFFSPGGVLAQSSLHYEHRKGQYEMAQAVEKAMDDKRHLIVEAGT
GTGKTLAYLLPAIRKARETQQRIIISTGTKNLQEQLFFKDIPFLESLLGPLKVCYMKGRS
NYLCKQKLYALRAQPLLSGLDEIDQFHILSNWEHETKTGDRAEVNGLPENSALWGKLDAR
SEACLGQTCPNFETCFVTEMRRKALESEIVIVNHHLFFADLNIKQQSGNAPDAGVLPDAL
AVVFDEAHEMEDVASDYFGVALSQQRFEELARDTESLLKAKNASSSSIESATIWLRERAR
VFFASLPQIGTTIGRMPFDDREGFLEERGDGYLGAVAALNRLESELERLKEVDEASGLRR
RVGEIRTSLKFLMEANDPNTVFWIERRSAGGVRNAAQGGQAFHTHLQATPIDVSELLTQT
LFESFSCVVLTSATLTVQGGFEHIRKRLGLVLPRELVVPSHFQYGKQALLYLPPYMPDPR
DSAYMPRAAERVRRVLEITKGRAFCLFTSYAQMRAMYERMLVEVPFPLLLQGTQPRRALL
DEFRATPNAVLFGTSSFWQGVDVQGEQLSCVIIDRLPFAVPNDPVVRARMEAIEAAGGKP
FYDLQIPQAVITLKQGFGRLIRSVEDRGVLMLLDARIQTQRYGKVFLDSLPPYRITSELG
DVEEFFAEPKAKG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgaccctgacccagaccgagccgcttcctaccctgcgggacttcttttcgccg
ggcggcgtgctggcgcagtcgtcgctgcactacgagcaccgcaagggtcagtacgagatg
gcgcaggccgtcgagaaggcgatggacgacaagcgccacctgatcgtggaggccggtacg
ggaacggggaagacgctggcgtaccttttgcccgccatccgcaaggcgcgcgagacgcag
cagcgcatcatcatctccaccggaacgaagaacctgcaggagcagcttttcttcaaggac
attccctttctggaatcgctgctggggccgctgaaggtttgctacatgaagggccgcagc
aactatctctgcaagcagaagctctatgccctgcgcgcgcagccactattgagcggtctg
gacgagatcgaccagttccacattctttctaactgggagcacgagacgaagacaggcgac
cgcgccgaggtgaacggcctgccggaaaactctgccctgtggggcaagctggatgcccgc
agcgaggcctgcctggggcagacgtgcccgaactttgagacgtgttttgtgaccgagatg
cgacggaaggcgctggaaagcgagatcgtgatcgtcaatcatcatctcttcttcgccgac
ctgaatatcaagcagcagtctgggaacgctccggatgctggcgtgctcccggatgcgttg
gcggtcgtcttcgacgaggcgcacgagatggaggatgtggccagcgattactttggcgtg
gctctttctcagcagcgctttgaagaactggcgcgcgatacggagtctctgttgaaggcg
aagaacgcttcgtcctcttcgatcgagtcggcaacgatttggctacgcgaacgggcgcgg
gtcttcttcgcttcgctgccgcagatcgggacgacgatcgggcgcatgcctttcgacgac
cgtgaaggttttctggaggagcgcggggatgggtatctaggcgcagtggctgcgctgaat
cggctggagtccgagctggagcgtttgaaggaagtggacgaagcttcgggtctgcgccgc
agggtgggagagatccgcaccagcctgaagtttttaatggaggcgaacgatcccaacacc
gtcttctggatcgagcgtcgctctgcgggcggagtgcggaatgcggcgcagggcgggcag
gcgtttcatacgcatctgcaggccacgccgatcgatgtttcggagctgttgacgcagacc
ttgtttgagagcttttcctgcgtggttctcacctcggctacgctgacggtgcagggcggc
ttcgagcatattcgcaagcggctggggctggtgcttccgcgagagcttgtggtgccttcg
cactttcagtatgggaagcaggcgctgctgtatctgccgccgtatatgcccgatccgcgt
gactcggcgtacatgccgcgagcggcggagcgtgtgcggcgcgttctggagattacgaag
ggtcgcgccttctgcctctttacgagctatgcgcagatgcgggcgatgtacgagcgcatg
ctggtggaggtgcccttccctctactgctgcaagggacgcagcctcgtcgtgccctgttg
gatgagtttcgtgccacgccgaatgcggtgctgtttggcacgagcagcttctggcagggg
gtagatgtgcagggcgagcagctctcgtgcgtgatcatcgaccgtctgccgttcgcggtg
ccgaatgaccccgtggttcgcgcgcgcatggaggcgattgaagctgcgggaggcaagccg
ttttacgatctgcagattccgcaggcggtgattacgctgaagcaggggtttgggcggctg
attcggtcggtagaggaccgcggcgtgctgatgctgctggatgcgcgtattcaaacgcag
cggtatgggaaggtctttctggatagcctgccgccgtatcggattacgagtgagctgggg
gatgtggaagagttctttgctgagcctaaggctaaggggtga

DBGET integrated database retrieval system