KEGG   Terriglobus saanensis: AciPR4_3533Help
Entry
AciPR4_3533       CDS       T01408                                 

Definition
(GenBank) hypothetical protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CarboxypepD_reg CarbopepD_reg_2 SdrD_B DUF4198
Motif
Other DBs
NCBI-ProteinID: ADV84286
UniProt: E8UYS0
Position
complement(4270835..4274362)
Genome map
AA seq 1175 aa AA seqDB search
MKTHVLALVMAVSAAASLPLCAQDAAPATPSATPAAPAAAIETQGGTIRGTVSAGAADPK
SLGVPLPGVAITATNSLTGKKYTTSTDVDGTYALAIPRNGRYVVRAELAAFAATTQEVLL
NSTAHAGTATFHMELASRVAARDAAAGAESTAGVNAQTLARGLQSLGIASGGDAQTSDAT
VGGGASGAALPSISGGSDLTDSVSVSGQTGTTNGLANFSEDEIRNRIQDAMTQARAGGGG
NGDIATAVVGMLGGMMGGGPGGMGGPGGGGPGGGGPGGGGGRGGGGGGFGGGAFRNMNPN
AIHGNVFYQGGNGALDATPYSLTGTAVKPAYSSNRYGGSFVGSPYIPGLTKPNPKQFVFL
NLTGGRTITPFNAYATVPTVAQRTGDFTGLTQTVNGVAVPVTIYDPTTGAPFVCNAQTNV
ICANRLSTAAQNLLTYYPMPNIATNTQNYNYQRIAAAGNNSAALSARFVRNIGAQPAFGG
RGGAGGGGGGRRQRQDAPKTLRQNLNASFNYQHGATDGLGTFAVQDTKAATDGYGLGVGY
SIGYGRFSDNTTLNWNRSHALTTNIYTGTPTDPTAAAGIAVPKPSAVATGFYSGLPTIGL
TNFTGFGGGNPTDSVNQTVAFGNAVSWSHKKHNLRFGFDVRRVHYDVLGSSNVLGSLTFT
GYATAAPSTVTTTASTPTGSSFADFLLGAPQQSKIQAASFKTYLRETVWDGYANDDFRLR
ANLTVNAGLRYEYFAPYVEKYDRLVNLDHNADFTQVSAVVANGTGPFSGKFPRSLVQPDR
TMFSPRIGIAYRPKWPKQIVIRAGYGINFNTGQYSRFARSLQSQPPFAITQTNTAGQSGC
GTYGSFTLANAFGCTVSTVTQNSFAVNRNYRLGRVQVLNADIQKTLPLGIVLNVGYNGSF
GGDLDLLRAPNHTATGVTSADATAFTYEDSIANSRFNSLTINARKRMQKGIALGASYVYG
HSIDNASSIGGSGGNVIAQNDQRLDLEYGNSSFDVRHSVTGNYVFELPFGPNRAFFNQGG
VMPKILDGFSVSGTFTFASGSYFTPSYASTIAQVASGGNYTLRPDRVFSQPISGPGSSAL
WFNSAAFTAPTSSSGYGTASRNSIEGPGTVNVNMSLARTQSFGGTKSFEARATANNVFNT
VQYSGINTVLNSATFGRVTSVASARQLTVQARYRF
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
ttgaagacacatgtactggctctagtcatggcggtgagcgctgccgcgtctctgccgctc
tgcgcgcaggatgccgcacccgcaacgccctcggccactccagcagcgcccgcggcggca
atagagacccagggcggcaccatccgcggaacggtcagcgcgggcgctgctgatcccaag
tcgcttggcgtcccacttcccggcgtcgccatcactgcgaccaacagtcttaccggcaaa
aaatacaccacctctacggatgttgacggaacctacgctctcgccatcccgcgtaacggg
agatacgtcgttcgcgccgaactggcagccttcgccgctacgacgcaggaggtccttctc
aactccacggcacatgcaggtacagctaccttccacatggaactcgccagccgtgttgcc
gcgcgtgatgccgcagcaggagccgaatcgaccgctggcgtcaacgcgcagacgcttgca
cgcggtcttcaatctctcggcatcgcttctggtggagatgcgcagaccagtgatgccacc
gttggcggaggcgccagtggagccgcgctgccctcgatctccggcggaagcgatcttacc
gattccgtcagcgtcagcggacagacaggaacgaccaacggcctcgccaacttctccgaa
gacgagatccgcaaccgcattcaggacgccatgacccaggcgcgcgctggcggcggaggc
aacggcgacatcgcgaccgctgtcgtcgggatgctcggcggcatgatgggcggaggcccc
ggcggcatgggtggtccaggtggtggaggaccgggaggtggtgggcccggtggtggtgga
gggcgcggcggtggtggaggcggctttggcggtggtgccttccgcaacatgaatcccaac
gcaatccatggcaacgtcttttaccagggcggcaacggcgcgctcgacgctacgccgtac
tcgcttaccggcactgccgtgaagcctgcttacagcagcaaccgttacggtggcagcttt
gtcggttcgccttatatccccggactcacgaagcccaacccgaagcagtttgtcttcctc
aatctcacagggggacgcacgatcacgcccttcaacgcctacgccaccgtgcctacggtg
gcacaacggaccggagacttcaccggtctcacgcagaccgtcaacggagtcgccgttccg
gtcaccatctatgatcccacgaccggtgcgcccttcgtctgcaatgcacagacgaatgtg
atctgcgccaaccgtctctccaccgctgcgcagaacctgctcacctactacccgatgccc
aacatcgcgaccaacacgcagaactacaactaccagcgcatcgccgcagcggggaacaat
tccgccgccctctccgcccgcttcgtacgcaatatcggcgcacaacccgccttcggcggt
agaggaggagcaggaggtggaggcggtggacgcaggcagcgtcaggacgcccccaagacg
ctgcggcaaaacctgaatgccagctttaactatcagcatggcgcaaccgacggtctcggc
acctttgccgtgcaggacaccaaggccgccacggacggctacggcctcggcgtcggttac
tccatcggatatggccgcttcagcgataacaccacgctcaactggaaccgctcgcacgcc
ctgacgaccaatatctacaccggcactcccaccgaccccacggcggctgcgggcatcgct
gtccccaagccatctgcagtcgcgaccggcttctacagtggcctcccgacgatcggtctt
accaacttcaccggctttggcggaggcaatccgactgacagcgtcaaccagaccgtcgcc
ttcggcaacgccgtcagttggagccataagaaacataacctccgcttcggcttcgacgtg
cggcgcgtccactatgacgtccttggttcttccaacgtcctcggctcactcacctttacc
ggctacgccaccgcggctccgtccaccgttacgaccactgccagcacgcccacgggaagc
tccttcgccgacttcctcctcggagctccacagcagtcgaagatccaggccgcatcgttc
aagacctatctccgcgagactgtctgggacggttacgccaatgacgacttccgtctccgc
gccaacctgaccgtcaacgccggtctgcgctacgagtacttcgcgccgtatgttgagaaa
tatgatcgcctcgtcaacctggatcacaacgcggacttcacgcaggtttctgccgtcgta
gccaatggcacggggcctttcagcggcaagtttccgcgctcgcttgtgcagcctgaccga
acgatgttttctccgcgcatcggcatcgcctatcgccccaaatggccaaagcagatcgtc
attcgcgcgggctatggaattaacttcaacacgggccagtacagccgttttgcgcgcagc
ctgcagtcacagccacccttcgccatcacgcagaccaacaccgccgggcagagtggatgc
ggaacctacggcagcttcacgctcgccaacgccttcggttgcactgtgtccaccgtcacg
cagaacagctttgccgtgaaccgcaactaccgcctcggtcgcgtgcaggtgctcaacgcg
gatattcagaagacgcttccgctcggcatcgtgctcaacgtcggctacaacggctcgttt
ggtggcgacctcgatctgctccgtgctccaaatcacaccgctaccggcgtgacctctgca
gacgctacggcctttacctacgaagactccatcgcgaactcgcgcttcaattccctgacg
atcaacgctcgcaagcggatgcagaagggcattgccctcggcgcaagctacgtctacggc
cactccatcgacaacgcctccagcatcggcggcagcggcggaaacgtgatcgcgcagaac
gaccagcgcctcgatcttgagtacggaaactccagcttcgatgtacggcattccgtcacg
ggcaactatgtcttcgagcttccgttcggccccaaccgcgccttcttcaatcaaggcggc
gtgatgccgaagatcctggatggcttctccgtctcgggtaccttcaccttcgcctcgggc
agctacttcacaccgagctacgcctctacgatcgcccaggtggcctccggcgggaactac
actctgcgtcctgaccgcgtcttctcgcagcccatcagtggacccggaagctctgctctc
tggtttaacagcgcggcctttactgcgcctacctcctcttccggttacggcacagcgtcg
cgtaactctatcgaaggccccggcacggtgaatgtgaatatgtccctcgcgcgtacgcaa
agcttcggtggaaccaagtctttcgaagcacgcgccaccgccaacaacgtcttcaacact
gtccaatactctggaatcaacacggtgctcaactcggcgacctttggccgcgtcaccagt
gtggccagcgcacgtcaactcaccgtccaagcgaggtatcggttttga

DBGET integrated database retrieval system