KEGG   Terriglobus saanensis: AciPR4_3537Help
Entry
AciPR4_3537       CDS       T01408                                 

Definition
(GenBank) transcriptional regulator, XRE family
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_37 HTH_31 HTH_3 YdaS_antitoxin RACo_linker HTH_26 HTH_1 HTH_23
Motif
Other DBs
NCBI-ProteinID: ADV84290
UniProt: E8UYS4
Position
complement(4278046..4278330)
Genome map
AA seq 94 aa AA seqDB search
MKDTSQQFENVWDALADTTEEAGNLRVRAELMQQIDAIVRNEKWTQVVAAAKCGVTQPRI
SDLLRGRVSLFSLDALVNIATALGRKVRVEIEAA
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatacatcgcagcagtttgaaaacgtctgggacgccctggcggatacaactgag
gaagcagggaatctccgcgtacgcgcagaacttatgcagcagattgacgccatcgtcagg
aacgaaaaatggacgcaggtcgtagccgcggcaaagtgcggcgtcacgcaaccgcgcatc
agcgatctgctgcgcggtcgcgtctcccttttctctctcgatgctctcgttaatatcgcg
accgccctcggccgcaaagtacgcgtcgaaatcgaggccgcatga

DBGET integrated database retrieval system