KEGG   Terriglobus saanensis: AciPR4_3542Help
Entry
AciPR4_3542       CDS       T01408                                 

Definition
(GenBank) signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
tsa  Terriglobus saanensis
Pathway
tsa02024  Quorum sensing
tsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    AciPR4_3542
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AciPR4_3542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tsa01002]
    AciPR4_3542
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     AciPR4_3542
Peptidases [BR:tsa01002]
 Serine Peptidases
  Family S26: signal peptidase I family
   AciPR4_3542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S24 Peptidase_S26
Motif
Other DBs
NCBI-ProteinID: ADV84295
UniProt: E8UYS9
Position
4281426..4282223
Genome map
AA seq 265 aa AA seqDB search
MSETVVEKQQAVEVVEERKETLLESISGMAFVLVVGLFVLTFVAQNFEIPSSSMVPTMLI
GDHLVVDHTTFAPPTKWMPLVHYRPVQHGDIIVFLKPNPESPDLILVKRAIGLPGDRIHL
RHGVLYLNGVAQVEPQISMPDDGDPMHGYQAYRDDFPSAPPDDSNITALWATELQSHIVN
GELVVPEGKIFGMGDNRLASLDGRFWGFIPKEAVLGRPMFIYWSFMTSEDQMYKTSANER
VAFMGHILLHIFDQTRWKRTFHRVV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagagacagtcgtggagaagcagcaggccgtggaagtcgtagaggagcgcaaggag
actctgctggagtcgatctccggcatggcgtttgtgctggtggtgggtctgtttgtgctg
acatttgtcgcgcagaactttgagattccgtcgtcttcgatggtgccgacgatgctgatc
ggcgaccaccttgtggtggaccacacgacctttgcgccgcccacgaagtggatgcccctg
gtgcactaccgccccgtacagcacggcgacatcattgttttcctgaagcccaatcccgag
tcgcctgacctgatcctggtaaagcgcgccatcggtctgccgggcgaccgcattcacctg
cggcatggtgtcctgtatctgaacggcgtggcacaggttgaaccgcagatctccatgccg
gatgacggtgacccgatgcacgggtaccaggcgtatcgcgacgattttccgagcgctccg
ccggacgatagcaatatcaccgcgctctgggcgacggagttgcaaagccacatcgtgaac
ggcgaactcgtggtgcccgagggcaagatcttcggcatgggcgacaaccgtctggcctcg
ctggatggccgcttctggggtttcattccgaaggaagccgtgctgggacgaccgatgttt
atctactggtctttcatgacgtcggaagaccagatgtacaagacgagcgcgaatgagcgc
gtggcgtttatgggccacattctgctgcatatctttgaccagacgcggtggaagcgtacg
ttccatagggtagtgtga

DBGET integrated database retrieval system