KEGG   Terriglobus saanensis: AciPR4_3543Help
Entry
AciPR4_3543       CDS       T01408                                 

Definition
(GenBank) AsmA family protein
  KO
K07289  AsmA protein
Organism
tsa  Terriglobus saanensis
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    AciPR4_3543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsmA
Motif
Other DBs
NCBI-ProteinID: ADV84296
UniProt: E8UYT0
Position
4282220..4283884
Genome map
AA seq 554 aa AA seqDB search
MTTLETKSGMSVLRKRLVIAACVLLALVVLALLPPLVNVNRFQRRIASSISRSVGRPVHL
DSVSMTLLPLPGFTLENFVVSEDPQFGSEPVMRADEVKATLRVSSLWRGKLEFSTISLTA
PSVNLVRNAAGRWNLETILLQASQIDAAPTQQKRAGSTPRFPYIEATDARVNVKLGDEKT
PFSLTGAEFALWLPDPQEWRLRLKAKPARTDTDASDTGELRVEATLRRAAKMSDVPIQAE
AVWRRTPLGEASKVLVGYDAGWRGDAAAEVKVDGTLGDASVTATLHMTDVRRSDFVPTRL
MEIDAHCEARATGVLRELRGLRCSIPVDAAALTGTEAGGQIEGVNAGTLALTGDLPSLFD
WKSADLQASLAGVAPGYALDWLRLFSQRIPQSLSATGEMHGTFSYGPGTAGLWAGSATCD
CALSLPVTTRGAVLSKTTTERLPIHADATIGSDGTGGRSLQIVASVSHALHPDKTVADLP
GGDAEASINGEGLRVHYPATTSTEFLEALERRLPPLMDGLPEGSGEWVSYRPWGGTQIWS
KPVAAPVHKRGHRG
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccctggaaacaaagagcggtatgagcgttctacggaagcgactggtgattgcg
gcatgcgtgctgctggcgcttgtggtcctggccctgctgcctccgctggtcaatgttaac
cgctttcagcggcgcatcgcgtcgagcatctccaggagcgtgggtcggccggtgcatctg
gacagcgtcagcatgaccctgcttcccttgcccgggttcactctggaaaactttgttgtg
agcgaagatccgcagtttggatcggagcccgtgatgcgcgccgatgaagtgaaggcaact
cttcgcgtgagttcgctgtggcgaggcaagttggagttttccacgatcagcctgaccgcg
ccgagcgtgaatctcgtgcggaacgctgccggacgctggaacctggagacgatcctgttg
caggcgtcgcagatcgatgcggctcccacgcagcagaagcgtgcaggttcgacgccgcgc
tttccctatatcgaagcaaccgatgcgcgcgtgaatgtaaaactgggcgacgagaagacg
ccgttcagcctgaccggtgcggagtttgccctgtggctgcccgatccgcaggagtggcgg
cttcgcctgaaggccaagcccgcgcgcaccgatacggacgccagcgatacgggagagctt
cgcgtggaggcgacgcttcgccgcgccgcaaagatgagcgacgttcccatccaggccgaa
gccgtctggcgacggacacctctgggtgaagccagcaaggttctggtgggatatgacgcc
ggttggagaggcgatgcagccgcagaggtgaaggtcgatggcacgctaggcgatgcctcc
gtgacggccacattgcacatgacggatgtccggcggtcggactttgttccgacgcgcttg
atggagatcgacgcgcactgcgaggcacgcgcaaccggagttctgcgggagctgcgtggt
ctgcgatgctcgattcccgtagacgccgcggctctgacggggacggaagctggcggccag
atcgagggcgtgaatgctggaacactcgctctgacgggcgacctgccgagcctcttcgat
tggaagtctgctgacctgcaggcgagcctggccggtgtggctcctggctatgcgctggac
tggctgcgtctgttttcgcagagaatcccgcaatccttgagcgctacaggcgagatgcat
gggacgttctcttacggtcccgggactgctggtctgtgggcgggaagcgccacctgcgat
tgcgccttgtctctgcccgtaacgactcgcggagctgtcctttccaaaacgacgacggag
cgtctgcccattcatgccgacgccaccattggcagtgatggaactggcggccgttcgttg
cagatcgtcgcgagcgtctcgcatgcattgcatccggacaagacggtcgccgatcttccc
ggcggagacgccgaagcttccatcaacggcgaaggtctgcgcgtacattaccccgcgacg
acctccacagagtttcttgaggcactggagagacgcctgccacctctcatggatgggctg
ccggagggatctggggaatgggtttcgtaccggccctggggtgggacgcagatctggtcc
aagccggtggcggcccctgtgcataagcgtggacacagaggttaa

DBGET integrated database retrieval system