KEGG   Terriglobus saanensis: AciPR4_3544Help
Entry
AciPR4_3544       CDS       T01408                                 

Definition
(GenBank) hypothetical protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M1
Motif
Other DBs
NCBI-ProteinID: ADV84297
UniProt: E8UYT1
Position
complement(4283935..4286085)
Genome map
AA seq 716 aa AA seqDB search
MKKLYPTLALCTTLLIPQLSVSQSAPFFRGTIAKGWGRAERTNGSQGKAATFPLMAALTY
PQDSQTTQPAPEPPKGTVVFQRHDEAAPDAPAPPPVAPELKPHGVSSSVPAEESQTAAEK
IPDADRQAIAITAYNLDMHLNLTTGATTTRARLTVRNDATSALTHIPLQISSSLKWQSAR
AGNKAADFEQHPLFTAADHTGTATEIVLNTPLAAGASIDLDLFYEGALTPSTERLEQIGA
PAPQAAASDWDGFGLPSETAVQGVRGMGNVLWYPVAQPPVFLGEGNNLFAAVGQSRLRQQ
EATFRLRLTLEFSGSIPDAAFFCGQRQPLVSLTPQETTADPAPTALATATWDFARLGFRT
PSLFVAVPSPTESPDHLLQVVTNHVDTVSSYTAAAKLAQPLLSAWLGASPLEELTLLDLG
TPNASPFEEGSTLALPLHITDAARLAPSMVHALTHAWSNSPEPWLSEGLATFMGQLYLER
LGGPTGRETALAAGEPELRALALYESSTVATDAAVSTSAMPEHPALTACPDPICYRTKGA
AIFQMLRTLAGEDALKQTLQAFRIAKNQDSASFEALLEKTSGKDLGWFFDDWVNHDRGLP
DLTIVNIAPRSIAPSTSTANGHGTLESTPTGQQVRTEGGWITAIAVSNDGGATTDVPVTL
RTGTFTTTERLRIPAHGRATVRMLTPAQPDEVTVNDGTTPELRSSTHTRSITERQP
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagctttaccccactctcgctctctgcaccaccctcctgatcccccaactctcc
gtctcccaaagtgccccattctttcgcggcactatcgcgaaagggtggggtcgcgcggag
cgcacaaacggatctcaggggaaagcagcgaccttcccgctcatggcggcattgacgtac
ccccaagactcccaaactacgcaaccggctcctgaaccccccaaaggcaccgtcgtcttc
cagcgccacgacgaagccgccccggacgctcccgccccgccgcccgttgcgccggagctg
aaaccccatggagtttcctcgagcgtccccgccgaagagtcgcagacggcagcggaaaag
atccccgacgccgatcgccaggccatcgcgatcacggcctacaacctggacatgcatctc
aacctgaccaccggagccaccaccacccgcgcccgcctgactgtccgcaacgatgccacc
agcgctcttacgcacatcccgctccagatctccagcagcctcaagtggcagagcgcccgc
gccgggaacaaggcggcggacttcgagcagcaccccctcttcaccgcagccgaccatact
ggcaccgcgacagagatcgtcctcaacacccccctggccgccggcgcctctatcgatctc
gacctcttctacgaaggcgcactcacacccagcaccgaacgcctcgaacagatcggcgcg
cccgcgccgcaggccgctgcctcggactgggatggctttggcctcccgtcggagacagcg
gtgcaaggcgttcgcggtatgggcaacgtgctctggtatccggttgctcagcctcccgtc
tttctcggtgaggggaacaacctcttcgccgccgttggccaaagccgccttcgccagcag
gaggctaccttccgcctccgccttaccctggaattctccggctccataccggatgccgcc
ttcttctgcggtcagcgccaaccgctggtttccctcacgccacaggaaactacagccgac
ccagctcccacagcgctcgccaccgccacgtgggatttcgcccggctcggctttcgcacg
ccgagcctcttcgttgctgtaccgtcgccaactgagagccccgaccaccttcttcaggtc
gtaaccaatcacgtggacaccgtttccagctacactgctgcggccaagcttgctcagccg
ctcctctcggcgtggcttggggcttcgccgctggaagaactgaccctcctcgacctcggc
acacccaacgcctcgccttttgaagagggaagcacgctcgctctaccgctgcacatcacc
gatgccgctcgcctggcaccctccatggtgcacgcccttacgcacgcttggtccaactcg
ccggagccctggctctccgaaggtctggcgaccttcatggggcagctctacctcgaacgc
ctcggaggcccgaccggccgcgagaccgcccttgccgccggcgaaccagaactgcgtgcc
ctcgctctctacgagtcctcgaccgtagctacggacgctgccgtctccacctccgccatg
cctgaacaccccgctctcaccgcctgccctgaccccatctgctaccgcaccaagggcgca
gccatcttccagatgcttcgtacccttgcgggtgaagatgctctgaagcagaccctgcag
gcctttcggatcgcaaagaatcaggactctgccagcttcgaggcgttgctggaaaagacc
tcagggaaggatctgggatggttcttcgacgactgggtgaaccatgaccgcggacttcct
gacctcactattgtgaacatcgcgccgcgctccattgcgcccagcacaagcacggccaac
ggccacggcacgctggaaagcacacccaccggccagcaggtccgaaccgaaggcggctgg
atcacggccatcgccgtctccaacgacggaggagccaccaccgacgtgcccgttacactc
cgcaccggaaccttcaccacaacggaacgcctgcgcattcctgctcacggtcgcgcgacg
gtccgcatgcttacccccgctcaaccggacgaagttacagtgaacgacggcaccaccccg
gaactccgaagcagcacgcatacccgctcgatcacggaacgccagccgtaa

DBGET integrated database retrieval system