KEGG   Terriglobus saanensis: AciPR4_3547Help
Entry
AciPR4_3547       CDS       T01408                                 

Definition
(GenBank) hypothetical protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AbrB DUF2516 Yip1 DUF4010 DUF4064 BatD DUF1129 Intg_mem_TP0381
Motif
Other DBs
NCBI-ProteinID: ADV84300
UniProt: E8UYT4
Position
4287580..4287927
Genome map
AA seq 115 aa AA seqDB search
MIERIDGRTQGANAAVVNRTRRAVRQRAEAMQAQRSRLKDLWLPLSLCSILLMMVCYAVW
AVMEQKTESSIPETSMLSSEPGGLSSILLLWLLPVSIAGIAMVWMRRNRSDEATR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagcggatcgacggaagaacacagggtgcgaatgccgctgtggtgaatcggacg
cgacgtgcggtacggcagagggcagaagcgatgcaggcgcagcggtcacggctcaaagat
ctgtggctgccgctcagcctgtgctcgatcttgctgatgatggtctgctatgcggtgtgg
gccgtgatggagcaaaagaccgaaagctcgattccggagacttccatgctttcctccgaa
ccaggtggactctcttccatcctccttctatggctgctcccggtgtccattgccgggatt
gccatggtctggatgcggcgcaacaggtcggacgaggcgacccgataa

DBGET integrated database retrieval system