KEGG   Terriglobus saanensis: AciPR4_3551Help
Entry
AciPR4_3551       CDS       T01408                                 

Definition
(GenBank) coagulation factor 5/8 type domain protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_64 F5_F8_type_C Ig_3 Ig_2 I-set
Motif
Other DBs
NCBI-ProteinID: ADV84304
UniProt: E8UYT8
Position
complement(4290112..4292028)
Genome map
AA seq 638 aa AA seqDB search
MKQYKICKWLSTCLGLSVLLSSSCALIAQKSQVAPTGPNLALGKPAKSSGDENASLGPAK
AVDGNLATRWSSAFADDEWIEVDLGSVQTINQVALNWQNSHAVQYNIQVSTDEAKWTDAL
VQTAGLGGVETPTFPPVSGRFVRMLGIKRSTIYGYSLFEFGVYGPAATAGPTITAQPASQ
TVTAGVTVTFTVAATGTGALSYQWLKNGVPISGANSASYVTPVLAIADSGTSYSVTVTDA
IGSVASNPAILTVNPGYTVYPGFVGTDLANNTKGAWPDDQIYVTVIGLDPQTGVFATVKP
DGTITDVSVADNDAAGHLTKNKNNYPNYAFTLAQSKLLKLPKMSSGRVFISMGEPVYLKI
LQDAKGNIGYAGPNPQNTTDPNENVPFDWYEFTYNNTGLFINTTQVDEFGLPLVLDVWGN
KATFHQQTGITESIAALDQEFVNETPAEFHTTPISNLRILSPTKTTFGAKGVNGQYFDAY
VANIWNMYSANPLIVNLFGNRRFTGTTTATSFNFTEVNLNNGAFVGNSYVVNRPTTQDIF
QCSGSMAKGDPTKDINTVELALEAQMCAAFNRHVMADVTTWATPSAFYLNSPTNSYAQFW
HRHSMGGLAYGFAYDDVSGQSSTISTGTPEHMVFTIGW
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatataaaatctgcaaatggctctccacctgccttggactaagcgtgcttctg
tcttcttcctgtgccttgatcgctcagaagagtcaggtggcgcctacaggccccaacctc
gctctgggcaagcccgctaaatccagcggcgatgaaaacgccagccttggcccggcgaag
gcggtggatggcaatctcgcaacgcgctggtcttctgctttcgcggatgacgaatggatt
gaggtcgatctgggttccgtgcagacgatcaatcaagtcgcactgaattggcagaattcg
catgctgttcagtacaacatccaggtctcgacggatgaggcgaagtggacggatgccctg
gttcagacggctgggttgggaggcgtagagactccgacctttcctcctgtcagcggccgc
ttcgtccgcatgctaggtattaagcgttctacgatctacggctattcgctgtttgagttt
ggagtctatggtcccgctgctaccgctggaccaacgattaccgcgcagcctgccagccag
acggttacagctggagtaacggtcacatttactgttgccgccaccgggacgggagcgctc
agttatcaatggctgaagaatggcgtaccgatctccggcgcaaacagcgcgagctatgtg
acgcccgtgcttgctatcgcagacagtggtacttcgtatagcgtcacggtcaccgatgcg
atcggctccgtcgcctcgaaccccgccatcctgacggtgaacccaggctataccgtttac
cccggctttgtcggcaccgatctggccaacaatacgaagggtgcgtggcctgatgatcag
atctatgtcacggtcatcggtctcgatccccagacgggcgtatttgctacggtcaaaccc
gatggcacgatcaccgatgtctcggtcgctgacaacgatgcggccggacaccttacaaag
aacaagaacaactaccccaattacgctttcactcttgcacagagtaagctgctcaaactg
ccgaagatgagctccggtcgcgtgttcatctccatgggagagcccgtctatctcaagatc
ctgcaggatgccaagggaaatataggctacgcaggacccaatccgcagaacactacagat
cctaacgaaaacgtacccttcgactggtacgaattcacctataacaacaccggcctcttc
attaacacgacgcaggtcgatgaattcggtcttccgttagtgcttgatgtatgggggaat
aaggctaccttccatcagcagaccgggatcactgaatcgatcgccgcgctcgatcaggag
tttgtgaacgagactcctgcggagttccacacgacccccatcagtaacctccgcatcctg
tctcctaccaaaacgacattcggtgcaaagggcgtcaatggacaatacttcgacgcgtat
gtcgccaatatctggaacatgtacagcgccaatcctctcatcgtgaatctctttgggaat
cgtcgtttcacgggcactaccaccgcgaccagtttcaacttcacggaggtaaacctcaac
aacggcgcctttgtcggcaattcctatgtcgtcaaccggcctacgacgcaggatattttt
cagtgcagtggatcgatggccaagggcgacccgacgaaggatatcaacacagtggagctc
gctttggaggcgcagatgtgtgctgccttcaaccggcatgttatggcggatgtcactacc
tgggcaacgccttctgccttttacctaaattcaccgacgaacagttatgcgcagttctgg
cataggcacagcatgggcggtcttgcctatggcttcgcatacgatgacgtctcaggtcag
agctcaaccatcagtacaggcactccggaacacatggtctttaccatcggttggtag

DBGET integrated database retrieval system