KEGG   Terriglobus saanensis: AciPR4_3553Help
Entry
AciPR4_3553       CDS       T01408                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ADV84306
UniProt: E8UYU0
Position
complement(4294341..4295651)
Genome map
AA seq 436 aa AA seqDB search
MQKAIPDITTASKSPRPFAASEAKLLWLSSLGSSLEFYDFVVFVFFTAVIGKLFFAPGIP
DWVRQTQTFGLFAAGYLARPLGGIVMAHFGDTVGRKRMFTLSVLLMATPTLLIGLLPTYQ
TIGIAAPLLLLLLRILQGIAIGGEVPGASVFVAEHARRDKVGFAIGLLTGGLSFGIFLGS
LMATSINLTFTQAEIAAGIWRVPFLVGGLFGLIAMWLRRWLKETPVFEEMQRRATLSQEM
PLSVVFQKHRRSVIVSMISTWMLTAAVVVVMLMTPTLMPKLFGLAPGALRIPNLVATAVL
CIANVAVGVATDKFGVRRVAIPSLLFLVLSTYGLYFGAAHMPSMLLTFYVFAAIGAASSV
LSPLVMVFAFPAKVRFSGVSVSYNLAYAIFGGLTPLLVSWLAHLDRFGPAHYVAAVAILC
LCALFIWPLADERQSS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagcaatccccgatatcacgactgcctcaaaatcaccgcgcccctttgcagcc
tccgaagccaaactactttggttatcttcacttggcagctctctggaattttatgatttt
gtcgtcttcgtcttctttaccgcggtcatcggcaagctgttttttgcccccggtattcct
gattgggttcgccagacccagaccttcgggctttttgccgccggttatctggcgcgtccg
ctgggcggcatcgtcatggcgcacttcggagacaccgtgggccgtaaacgcatgtttacg
ctgagcgttctgctcatggctactccgacgctgctcattgggctgctgcccacctatcag
accatcggaatcgcggcccctttgcttctcctcctgctccgcattttgcagggaatcgcc
atcggcggagaggttcctggggcctcggtcttcgtcgctgaacatgcgcggcgcgacaag
gtcggtttcgccatcggcttactcaccggcggcttgagcttcggtatcttcctgggctcg
ctgatggcgaccagtatcaacctgacgtttactcaggccgaaatcgccgcaggtatctgg
agggtgccatttctcgtcggcggtctctttggcctgatcgccatgtggctgcgtcgctgg
ctcaaagagacgccagtcttcgaagagatgcagagacgcgcaaccctctcccaggagatg
cctctgagtgttgtcttccagaagcaccgaagatcggttatcgtttcgatgatctccaca
tggatgctcaccgcagcggtcgtcgtagtcatgctgatgactccgaccttgatgccaaaa
ctctttggattggcgcctggggcattgcgtatcccaaacctggtcgcgacggctgttctc
tgtattgcaaacgtcgcggtgggcgttgcaaccgataagttcggtgtccgtcgagtggca
atcccctccttgctctttctggtcctttcaacctacggactctattttggcgcggcgcac
atgccttccatgctcttgacgttctacgtgtttgctgccatcggtgcagccagtagtgtg
ctctcgccccttgtgatggtctttgcatttccggcgaaggttcgcttcagcggagtctct
gtctcttacaacctcgcctatgcaatctttggaggcctcacgccgctattggtttcatgg
cttgcgcatcttgaccgattcggtcccgcacactacgtcgcagcggtagcgatattgtgc
ctctgtgccctttttatttggcctctggcagacgagcgccagtcttcttag

DBGET integrated database retrieval system