KEGG   Terriglobus saanensis: AciPR4_3554Help
Entry
AciPR4_3554       CDS       T01408                                 

Definition
(GenBank) Rieske (2Fe-2S) iron-sulfur domain protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske
Motif
Other DBs
NCBI-ProteinID: ADV84307
UniProt: E8UYU1
Position
4295926..4297023
Genome map
AA seq 365 aa AA seqDB search
MTPTVAPDSDSFVSTADLLSSAVPSKETLPRDCTFSASDWHALAPFWYPVAFSSEVTDKP
YGARLLDERVVVYRLSDGSLAAAKDICYHRGAPLSLGHVEGDEIICKYHGLRYNAEGRCT
CIPAHPKGAISPRLRLHTFPVREAFGLVWVRLVERGEALLPEMKEWDDPSYLQVLPDSVT
MKASAGRQMEGFLDVSHFAFVHLETFGKGENPEVPDYTVEQTPQGFVADYYSTVSNYSVG
YKHLNPPGFLWRRRFEVFTPFTAKLTVFFPGDGQLHILNVASPVSARKTRLFVPICRNFD
RDAPLQATLDFNHQVFAEDQAIVEQQYPEDLPLDLQAEAHFPADRSSIAYRKRLAALGLG
RSFTA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgacccccacagttgcacccgactcagattccttcgtctccactgcagaccttctctct
tccgcagtgcccagcaaggagaccttgccgcgagattgcaccttttccgcatcggactgg
catgctctggctccgttctggtatccggtcgctttttccagcgaggtcacagacaaaccc
tatggggcgcggctgctcgacgagcgagtggtggtctatcgactctcggatggatcgctc
gccgccgccaaggacatttgctatcaccgcggagctccgctcagtcttggacacgtcgaa
ggcgacgagattatctgcaaatatcatggcctgcgctataacgcagaagggcgctgcacc
tgcatccccgcacacccaaagggagcgatctcccctcgcttgcgtctgcacacgttcccc
gtacgggaggcgtttggtctagtgtgggtccgtctggtggagagaggcgaagctttgctt
cctgagatgaaagagtgggacgatccttcgtatcttcaggtcctgccggacagcgtgacg
atgaaggcttcggcgggacgtcagatggaaggctttctcgatgtaagtcatttcgccttc
gtccatttagagaccttcggcaagggggagaacccggaggttcccgactacacggtggag
cagaccccgcagggttttgtggccgattactacagcacggtaagcaattattccgtgggt
tataaacacctcaatccacccggcttcctttggcgtagacgcttcgaagtctttacgccg
tttacagcaaaactgaccgtcttctttccaggggacgggcagttgcacatcctcaatgtt
gcttctcccgtgtccgcgcggaagacgcgtctgtttgtaccgatctgccgcaacttcgat
cgggacgcgcctttgcaggccacgctcgatttcaatcatcaggtcttcgcggaagatcag
gccatcgtcgaacaacaatatcccgaagaccttcctctcgatcttcaggcggaggcccat
ttccctgcggacagaagttcgattgcctatcgcaaaagacttgccgctcttggtctgggc
aggagcttcacggcgtag

DBGET integrated database retrieval system