KEGG   Terriglobus saanensis: AciPR4_3556Help
Entry
AciPR4_3556       CDS       T01408                                 

Definition
(GenBank) Peroxidase
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C
Motif
Other DBs
NCBI-ProteinID: ADV84309
UniProt: E8UYU3
Position
complement(4297969..4298625)
Genome map
AA seq 218 aa AA seqDB search
MSLRINEVAPDFVAETTQGPIKFHEWIGDSWAVLFSHPKNFTPVCTTELGAVAALEKQFA
ARGAKVIGLSVDPVESHGRWLEDIYDVSGNKVDYPIIGDPELKVSKLYDMLPADAGNSSE
GRTPALNAPVRTVFVVDPAKRIRLTLAYPMTTGRNFEEILRALDSMLLTSKHRVATPANW
GRGDDVIITAGVSDEEAKTVFPGYRTIKPYLRMTKQPQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctccgaatcaatgaagtcgctcccgattttgtcgcagaaacgacccagggtccc
attaagtttcacgaatggatcggcgacagttgggctgttctgttctctcatccgaaaaat
ttcaccccggtatgcaccacggagcttggcgctgtggcagccctggagaagcagtttgct
gcgcgtggcgcgaaggtgatcgggttgagtgtggatcctgttgagagtcacggacgatgg
ctggaagatatctacgacgtaagcggcaacaaggtggattaccccatcatcggagatccg
gaactcaaagtctccaagctctacgacatgcttcccgcagatgcgggaaacagctcggag
ggccgtacgcctgcactcaatgcgcccgtccgtaccgtctttgtggtggatccggctaag
cgcatccgtctcacgctcgcttatcccatgacgaccgggcgtaacttcgaggagatcctg
cgtgcgctcgactcgatgttgcttacttcaaagcaccgggttgctacgcccgcgaactgg
gggcgaggcgatgatgtgattattacggcaggcgtctcagacgaagaagcgaagaccgta
tttcccggctatcggacgatcaagccctatctgcgtatgacaaaacagccgcaatag

DBGET integrated database retrieval system