KEGG   Terriglobus saanensis: AciPR4_3558Help
Entry
AciPR4_3558       CDS       T01408                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Ndr Esterase PGAP1 Chlorophyllase2
Motif
Other DBs
NCBI-ProteinID: ADV84311
UniProt: E8UYU5
Position
4299432..4300199
Genome map
AA seq 255 aa AA seqDB search
MMKFLKKENLSLAYTDTQTSLPAVLLIHGCGCDHTHFAPLAELLSPYHRVVNVDLRGHGE
SDAPHNEYTMASLADDLAWLCGELRLEKPVAIGHSMGGNVGLELSARHPDLLRALVMVDS
VVVPSQPVREALAPLDEVLQKPDYLSAFRQLLSGLCLPTDKRSFEVIASVKVPQHVVIST
IKNHATQYDASSVAAACLTPIAYIGAAVPLADLDRFRTLTPQLVTAHVLGSVHFIPLEVP
DQLNAMISRFLANLN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatttttgaaaaaagagaatctctctcttgcttataccgacacccagacctct
ctcccagcggtccttcttatccacggttgcggttgcgaccacacacacttcgcccctctg
gcggagcttctcagcccgtaccaccgcgtcgtcaatgtcgatcttcgcggccacggtgag
agcgatgcgccgcacaacgaatatacgatggcctctcttgcggatgatctcgcatggctc
tgtggcgagctgcgtttggaaaagccggttgcgatcggtcacagcatgggagggaatgtg
gggttggagctctccgcgcgtcatccagatcttcttcgcgcacttgtgatggtcgactcg
gtggtcgtcccgtcgcagccggtccgtgaggctctcgcaccgctcgacgaagttctccag
aaaccggactatctctctgcgtttcggcaactgctctcaggactttgcctccccacggat
aaacgctccttcgaagtcatcgcttcggtgaaggtaccgcaacatgttgtgatctccact
atcaaaaatcacgccacgcaatacgatgcgtcctctgtcgcagcggcgtgtctcactccg
attgcttatatcggtgcggcagttccgctggccgatctggatcgctttcggaccctgacg
ccacaactcgtcacggcgcatgtgctgggatccgtccacttcattcctcttgaggttccg
gatcaattgaatgccatgatctccaggttccttgcaaatctgaactaa

DBGET integrated database retrieval system