KEGG   Terriglobus saanensis: AciPR4_3560Help
Entry
AciPR4_3560       CDS       T01408                                 

Definition
(GenBank) Oxidoreductase FAD-binding domain protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_6
Motif
Other DBs
NCBI-ProteinID: ADV84313
UniProt: E8UYU7
Position
complement(4300770..4301462)
Genome map
AA seq 230 aa AA seqDB search
MDRPTLTARLTGRRLLAAPSQTFLLSFTTEDEADFDFVPGQFVSVVSDSTYPEGHTKAGQ
PRQETRAYSLASAPRGPHFELCLNRVGAFSETLCSLAMEDIIRVHGPHGTFTRREGQAPA
LYVGADAGIVPIRSIFRAAVPPHSTLVQIAATREDLLFRDEFAASPGMRYLPMVAPEADF
VEAQIRKLLSAHPEIQTAYLCGLNASISPIRDLLKSLSWDRKQIVFERYD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccccacactcaccgcgcgtctcaccggacgccgcctgctcgctgcccccagc
cagacttttcttctctccttcaccacggaggacgaggcagacttcgacttcgtgcccggg
cagttcgtctccgtcgtgagcgacagcacttatcccgaaggccacaccaaggcaggccag
ccgcggcaggagacacgtgcctactcgctggcctccgcgccacgtgggccacactttgag
ctctgcctcaatcgcgtcggtgcattctccgagacgctttgcagtcttgcgatggaagac
atcattcgggttcatgggccacatggaaccttcacccgccgcgagggacaggcgcccgca
ctctacgtcggcgccgatgcgggcatcgttcccatccgcagtatcttccgcgctgccgtg
ccgccgcactctacgctggtgcagatcgctgccacgcgggaagatctgctctttcgcgat
gagttcgctgcctctccaggaatgcgttacctacccatggtggcgcctgaagcggacttc
gtggaggcacaaatccgcaagcttctttcggcacacccggaaatccagaccgcttacctc
tgcggtctgaatgcttccatcagcccgatccgcgatctactcaaatctctgagctgggac
cggaagcagattgtcttcgagcgttacgactaa

DBGET integrated database retrieval system