KEGG   Terriglobus saanensis: AciPR4_3565Help
Entry
AciPR4_3565       CDS       T01408                                 

Definition
(GenBank) repressor protein, putative
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WYL HTH_11 HTH_24 Rrf2 HTH_IclR HTH_29 MarR_2 HTH_36 TFIIE_alpha Sigma70_r4_2 Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID: ADV84318
UniProt: E8UYV2
Position
complement(4306393..4307358)
Genome map
AA seq 321 aa AA seqDB search
MYDPIMRVFTVLEILQTRDHVTGAELAERLEVDLRTVQRYIVRLKDLGIPISSSSGVGGA
YRLRPGYRLPPLLLTNEEAFALALGLRALRQVGLAAFAPATEGALAKLGRVLPETLRESI
RTVEDVVSMEPSPWVVPASVESLIGASTAIRTGQCIRFGYQSHNETTSHREIEPYAVMHT
DGRWYLIGHCLSRQAMRTFRLDRLTNLEICTATFQPPTSFDARRYLAEHMPFVQSDYQID
VWIDMPIEEANRSFALWRVATEAHEGGTRLRCGRDHLEMFAAVLLSMRRRIVVHSPSELR
ETFRELARLAIQVADGPCADL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacccgatcatgcgcgtcttcaccgtcctcgaaattctgcagacgcgcgaccat
gtaaccggcgcggaactcgccgagcgtttggaagtcgacctgcgcaccgtgcagcggtac
atcgttcgtctgaaggacctcgggattcccattagctcttcttccggtgtaggtggggcg
taccgcctgcggccgggctatcgactgccaccactgctgctgacgaacgaggaggcgttc
gcgctggccttggggctgcgcgctctgcgccaggtgggcttggcggcgtttgcacctgcc
accgaaggcgccctcgccaagctgggacgtgtcctgcccgagacgctgcgcgaaagtatc
cggaccgtggaggatgtggtgtccatggagccaagtccctgggtggttccggcgtcggtg
gaatctctcatcggcgcttccaccgcaattcgcaccggccagtgcatccgcttcggctac
caatcccacaacgaaacgacctctcaccgggagatcgagccctacgccgtgatgcacacc
gacggacgctggtatctgatcggccactgcctgtcgcgacaggcaatgcgcacctttcgc
ctcgaccgtttgacgaacctcgaaatctgtaccgcgacgttccaaccgccgaccagcttc
gatgcccgccgctacttggcagagcacatgcccttcgttcaatccgactaccagatcgat
gtgtggatcgacatgcccattgaggaggccaatcgcagcttcgcactctggagagtggct
acggaagcacatgaaggcggcacacgcctgcgttgtggtcgggatcaccttgagatgttc
gcagccgtgctccttagcatgagacgccggatcgttgtccatagtccctccgaattgcga
gagaccttccgcgaactggcccgactggcgatacaggttgcggacggcccttgcgcggat
ctctga

DBGET integrated database retrieval system