KEGG   Terriglobus saanensis: AciPR4_3567Help
Entry
AciPR4_3567       CDS       T01408                                 

Definition
(GenBank) Tetratricopeptide TPR_1 repeat-containing protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_16 TPR_8 TPR_12 TPR_11 fn3_3 TPR_19 TPR_17 TPR_9 TPR_14 TPR_21 DUF4897 SieB DUF3536 CarboxypepD_reg
Motif
Other DBs
NCBI-ProteinID: ADV84320
UniProt: E8UYV4
Position
complement(4308010..4309131)
Genome map
AA seq 373 aa AA seqDB search
MKLTAPFRATLAAAALALLAFVPATSALAQAAPGSIHGHVQNYGGIAVKTGEVRLSTDRS
SEEKARKYAYTFPVDANGNFVGKDIKPDDYVLFYYDQGKSIDFLDHVIIKAGADTLADDD
MTREEYVKHLTPEEKKQLDEFKKKNAEVMATNSKVANVNALLTKARDEMKANNFDAALTD
MQQATAAKPDEPLLWIELGNAQLGAKKYDDAIVSFQKTIDLNAASKKPQPTLAGAAYNQL
GQSYARSSKLKEASDAYEKAAQAEPAKAGMYYFNEAATLYNVNNRDEAGVAADKAIAADP
TKADAYYIKAQSLIGKSTVDPKSQKIVPPPGCVEAYEKYLEIAPTGPHAPEIKQIVAAFD
DKVVSNYRAGKKK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaccgcccccttccgcgcaactctcgcggccgctgctctcgctcttctggca
ttcgttccggctacgagcgctctggcccaggccgcccccggtagcatccacgggcatgta
cagaactatggcggaatcgcagtcaagaccggcgaagtccgcctcagcacggaccgctcg
tccgaagagaaggcacgcaagtacgcctataccttcccggtagacgccaatggtaacttc
gtaggcaaagacatcaagcccgacgactacgtcctcttctattacgaccagggcaagtcc
atcgacttcctcgaccacgtcatcatcaaggccggcgcagatacgctcgccgacgatgac
atgacccgcgaagaatatgtcaagcacctcacgcccgaagagaagaagcagctcgacgag
ttcaagaagaagaacgccgaagtcatggccaccaactccaaggtcgccaacgttaacgcc
cttctgaccaaggcgcgcgacgagatgaaggcgaacaactttgacgctgctctgaccgac
atgcagcaggccacggcagctaagcccgacgaaccgctcctctggattgaactcggcaac
gcccaactcggcgccaaaaagtatgacgacgccatcgtctccttccaaaaaacgatcgac
cttaacgcggcctccaagaagccgcagccgacgctcgcgggtgctgcctacaaccagctt
ggccagtcctatgctcgctccagcaagctgaaggaagcctctgatgcttacgagaaggca
gcccaggcggaacccgccaaggctggcatgtactacttcaacgaagctgccacgctctac
aacgtgaacaaccgcgatgaggccggtgtcgccgccgataaggcgatcgctgcggacccg
accaaggccgatgcctactacatcaaggcgcagtctctaatcggcaagtccaccgtggat
ccgaagtcgcagaagatcgttcctcctccgggatgcgtcgaagcctacgagaaatacctc
gaaatcgctccgaccggcccccatgctccggaaatcaagcagatcgtcgcagcctttgac
gacaaggtcgtctcgaactatagggctggcaagaagaagtaa

DBGET integrated database retrieval system