KEGG   Terriglobus saanensis: AciPR4_3575Help
Entry
AciPR4_3575       CDS       T01408                                 

Definition
(GenBank) hypothetical protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4203 LapA_dom DUF4118 IncD Claudin_2 DUF4131
Motif
Other DBs
NCBI-ProteinID: ADV84328
UniProt: E8UYW2
Position
complement(4314356..4314613)
Genome map
AA seq 85 aa AA seqDB search
MGRNLYILAATLGFFGAVCFVLAFTGLVHEPGSPSDSVLWRTMGIFLVAGALIAALLGVL
QTMFEQAERRDEKHRIDQRERNRKH
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaatctctacatcctcgccgccacactgggtttcttcggagccgtctgcttc
gtgctggcctttaccggcctcgtgcatgaacccggctccccgtccgacagtgtcctgtgg
cgcaccatggggatctttcttgtcgctggagcactgatcgcagccctgctcggggtcctg
cagactatgttcgagcaggcggagcgccgcgacgagaagcaccgcatcgatcagcgggaa
cggaaccgcaagcactaa

DBGET integrated database retrieval system