KEGG   Terriglobus saanensis: AciPR4_3578Help
Entry
AciPR4_3578       CDS       T01408                                 

Definition
(GenBank) hypothetical protein
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5522 FeoB_associated
Motif
Other DBs
NCBI-ProteinID: ADV84331
UniProt: E8UYW5
Position
complement(4315910..4316083)
Genome map
AA seq 57 aa AA seqDB search
MSENPTDIPLEPGDSYMDGPYLVFTAQYLLKQGYCCGNNCRHCPYGNSDEDRAALAK
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaaccccaccgatattccgcttgagccaggcgactcctacatggatgggccc
tatctcgtcttcacggcgcaatacctgttgaagcagggatactgctgcggcaacaactgc
cgccactgcccttacggcaacagcgacgaagatcgcgcagcgctggcgaagtga

DBGET integrated database retrieval system