KEGG   Terriglobus saanensis: AciPR4_3588Help
Entry
AciPR4_3588       CDS       T01408                                 

Definition
(GenBank) cytochrome c, class I
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Oxidored_molyb Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ADV84341
UniProt: E8UYX5
Position
complement(4330185..4331069)
Genome map
AA seq 294 aa AA seqDB search
MAGLLSFAAVSPDTKKVGIQELPPFHDKLPLHESRIASEDLTVSGDLPGLPAKAVRFVSY
PDLLRLPQVNFKVTDDPNFKEATEIGGVYLEEVLRALGISEEGTLIAAICDDKYEAHYPV
AYRAAHHPILVLQINGKPLSQRSRTGDGGTYGPYLISHASFTPRFRVLSYAEEAQIPNGV
LELRFSKEHEVFEAIHPRGPSAGGSSQRLGYTIARENCFRCHNSGDYGGNKSGRPWSSLA
RLAQTNPEDFARYIKDPHSVNRFAQMPGFPEYDEVTLSALTAYFQTFASGSSSQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcctgctctcgtttgccgcagtttcgcccgatacgaagaaggttgggatacaa
gagctgcctccgttccatgacaagcttccgttgcatgagagccgcattgcatcagaggat
ttgaccgtctccggcgatttgcccggactacctgcgaaggccgtacgcttcgtctcatac
cccgacttgctcaggcttccccaggtcaatttcaaggtaacggacgatcccaatttcaaa
gaggcgacggagattggcggtgtttatcttgaagaagttctgcgcgcgctcggtatatcc
gaagaaggtacgctgatcgccgcgatctgcgacgacaagtacgaagcccactaccccgtt
gcataccgggccgcgcatcaccccattcttgtcctgcagatcaacggtaagccgctaagc
caacggtctcgaaccggagacggaggcacgtatggtccatatctgatctcgcacgcctcg
ttcaccccaaggtttcgagtactcagttacgcggaagaggcgcagataccgaatggtgtg
cttgagttgcgattctccaaagagcatgaggtctttgaggcgatccatccgcgcggcccc
tccgctggaggctcatcccagaggttgggctatacgatcgcacgggaaaattgcttccgt
tgccacaattctggtgactatggtggaaacaagtcgggcaggccctggagttcactcgcc
cgccttgcccagacaaatccagaagactttgcgcgctacatcaaagaccctcactccgta
aacaggttcgcccagatgccgggctttccggaatacgatgaggtaacgctctccgcattg
acagcctattttcaaaccttcgcttccgggtcatcgtcccaatga

DBGET integrated database retrieval system