KEGG   Terriglobus saanensis: AciPR4_3596Help
Entry
AciPR4_3596       CDS       T01408                                 

Definition
(GenBank) Domain of unknown function DUF1843
Organism
tsa  Terriglobus saanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1843 Phage_GP20
Motif
Other DBs
NCBI-ProteinID: ADV84349
UniProt: E8UZK6
Position
complement(4343821..4344186)
Genome map
AA seq 121 aa AA seqDB search
MSETGSHHPIPLYAVSIHNAAASGDLAAMKKTVTDAEEHLKTYGNVGAAVEALKVEIAKL
ESDTKGPIIRPLYGRPIDDAIKSGDLQKMKAIAAEAKSYKGSDISAEVKKLNAEIAKLEG
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacaggttcccaccaccccatccctctgtatgccgtcagtattcacaatgca
gcggccagcggcgatctagctgctatgaagaagactgtcaccgatgccgaggagcatttg
aagacgtacggcaacgtgggcgcggccgtagaagcgctcaaggtagagatagccaagcta
gaatccgatacaaaaggcccaatcattcgcccgctctacggccgtcctatcgacgacgcg
atcaagagtggcgatttgcaaaagatgaaggctatcgctgctgaagcaaagagctacaaa
ggcagcgacatctctgctgaggtcaaaaaactcaacgccgagattgccaaactggaaggt
aagtaa

DBGET integrated database retrieval system