KEGG   Thermus scotoductus: TSC_c01820Help
Entry
TSC_c01820        CDS       T01414                                 

Definition
(GenBank) phenylacrylic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
tsc  Thermus scotoductus
Pathway
tsc00130  Ubiquinone and other terpenoid-quinone biosynthesis
tsc00627  Aminobenzoate degradation
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01120  Microbial metabolism in diverse environments
tsc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tsc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    TSC_c01820
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TSC_c01820
Enzymes [BR:tsc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     TSC_c01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ADW20824
UniProt: E8PJX2
Position
155312..155893
Genome map
AA seq 193 aa AA seqDB search
MEAMAELPRVVVGLTGASGMPYALDLLESLQGLAEVHLVLSQGAKRVLWEEMGLSPKDLY
PLASRVYKDGDLGAPIASGSFRTQGMVVVPCSATTLSKIALGLADTLLTRAAYVHLKERR
PLILVPREAPLPLPTLRAMVQATEAGALILPASPGFYHRPKEIRDLLGFITQRILDHLGL
SAERAPRWGEPPS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaagccatggcggaacttccccgggtggtggtgggcttgacgggggcgagcggcatg
ccctacgccctggaccttttggaaagcctgcagggccttgccgaggtgcacctggtctta
agccagggggccaagcgggtcttgtgggaggagatgggcctgagcccgaaggacctctac
cccttggccagccgggtgtacaaggacggcgacctcggtgcccccatcgcctcgggttcc
ttccgtacccagggcatggtggtggtgccctgttccgccaccacccttagcaagatcgcc
ctgggcctggcggataccctcctcacccgggcggcctacgtgcacctgaaggaacggcgc
cccctgatcctggtgccccgggaggctcccctgcccctccccacccttagggccatggtg
caggcgacggaggccggagccttgatcctcccggcgagccctggcttctaccaccggccc
aaggagatccgggaccttttgggcttcatcacccagcgcatcctggaccacctgggcttg
agcgccgagcgggctccccgctggggtgagcccccctcctga

DBGET integrated database retrieval system