KEGG   Thermus scotoductus: TSC_c19210Help
Entry
TSC_c19210        CDS       T01414                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
tsc  Thermus scotoductus
Pathway
tsc00052  Galactose metabolism
tsc00561  Glycerolipid metabolism
tsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TSC_c19210
  Lipid metabolism
   00561 Glycerolipid metabolism
    TSC_c19210
   00600 Sphingolipid metabolism
    TSC_c19210
Enzymes [BR:tsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TSC_c19210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_31 Melibiase_2 Raffinose_syn
Motif
Other DBs
NCBI-ProteinID: ADW22534
UniProt: E8PMS1
Position
complement(1824772..1826220)
Genome map
AA seq 482 aa AA seqDB search
MRLEFSDPLRESRLEVPVLAEALGPVPGGYLLRGREVRVFAPFASKRFCRHGWQSWSLTT
WVDLNFPPKPLFPEARRPQADDPFLLEASEWWGSGLGALEGPDGKVLLLGALGVGARVLG
REDLLLGRYAEEEGEWFLGYGEPTEVFAAYGRLLPRRLSKGPPRLWCSWYSFYNRIHEAL
LLEVLEEVAGLPFEVFQIDDGWQRALGDWEPNERFPRGMAFLAERIREKGFRAGLWLAPF
LVTPDSPLVRAHPEWILRDGEGRPIPAGFNWWKPLYALDSGNEEVLDHVAGLVRKVRAWG
YDYLKLDFLYAAALPGAEGEVRYRKAMERIREEAGEAYLLFCGAPILASLGLADGLRVGP
DVAPYWDNEDRSFWLQDPTGPGLRNALRTTLHRLWLRENVQVDPDVAFFRSRFSLLSLEE
MRLQEAMGEITGFKATSDPPSWLSPEERERLWAFLSRDKEVKPLGPYRFRVGEEVLDYAF
LL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcggctggagttctcggatcctcttcgggaaagccgcctcgaggtgccggtcctggcg
gaggccttggggcctgttcccgggggttacctcctgaggggccgggaggtgcgggtcttt
gctccctttgcctcgaagcgcttctgccgccacggctggcagagctggagcctcaccacc
tgggtggacctaaactttcccccgaagccccttttccccgaggcccgcaggccccaggcg
gacgaccccttcctcctcgaggcttccgagtggtggggaagcggcctaggggccctcgag
gggccagatgggaaggtacttctcctgggggccctgggcgtgggggcgcgggtcttgggg
cgcgaggacctcctcctgggccgctacgccgaggaggagggggagtggtttctgggctac
ggggagccaacggaggtgttcgccgcctatggcaggctccttcccaggcggctttccaaa
gggcctcccaggctgtggtgctcctggtatagcttctacaaccggatccatgaggccttg
ctcctcgaggtgctggaggaagtggccgggcttccctttgaggtcttccagatcgacgac
ggctggcagcgggcccttggggactgggaacccaacgagcgcttcccccgggggatggcg
tttttggcggagaggatccgggaaaagggcttcagggcggggttatggctggctcccttt
ttggtgacgccggatagcccccttgtgcgggcccatcccgagtggatcctgcgggacggg
gagggaaggcccatccccgcgggcttcaactggtggaaacccctatacgccctggattcg
ggcaacgaggaggttttggaccatgtggcgggcttggtgcgcaaggtgcgggcctggggg
tacgactacctgaagctggatttcctctacgccgctgctttacccggggccgagggggag
gtgcggtaccgtaaggccatggagcggatccgcgaggaggcaggggaggcctaccttctc
ttttgcggcgctcccatcctggcctccttggggcttgccgatggcctcagggtgggtccg
gatgtggccccctactgggacaacgaggaccgctccttctggctacaggaccccacgggc
ccggggctaaggaacgccctccgcaccaccctgcaccggctttggttgcgggaaaacgtc
caggtggacccggatgtggcctttttccggagccgtttctcgttgctgtcccttgaggag
atgcgcctgcaggaggccatgggggagatcacgggcttcaaggccacctccgacccgccc
tcctggctttccccggaggaaagggaaaggctttgggccttcctaagccgggataaggag
gtaaagccccttggcccctaccgtttccgggtgggggaggaggttttggactatgccttc
cttttataa

DBGET integrated database retrieval system