KEGG   Thermus scotoductus: TSC_c23930Help
Entry
TSC_c23930        CDS       T01414                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tsc  Thermus scotoductus
Pathway
tsc00010  Glycolysis / Gluconeogenesis
tsc00052  Galactose metabolism
tsc00500  Starch and sucrose metabolism
tsc00520  Amino sugar and nucleotide sugar metabolism
tsc00521  Streptomycin biosynthesis
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01120  Microbial metabolism in diverse environments
tsc01130  Biosynthesis of antibiotics
tsc01200  Carbon metabolism
Module
tsc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSC_c23930
   00052 Galactose metabolism
    TSC_c23930
   00500 Starch and sucrose metabolism
    TSC_c23930
   00520 Amino sugar and nucleotide sugar metabolism
    TSC_c23930
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TSC_c23930
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TSC_c23930
Enzymes [BR:tsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TSC_c23930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: ADW22993
UniProt: E8PQF4
Position
2244417..2245325
Genome map
AA seq 302 aa AA seqDB search
MTVVGLDLGGTKIAAGVFDGTRLLSKVVLPTPEEGGMAVVQALAEATRKAEAEAGVEGVA
IGLGTPGPLDFKEGVIRFTPNIRGLVNFPIRRLLEEATKRPVHLENDANAAALAEHHLGA
ARGEGSSLFLTVSTGIGGGVVLGGRVLRGERGQGGELGHITLLPGGPVCGCGLEGCLEAL
AAGRALEREASYAYHRKVDTKELFQLFQEGEPRARRILLQAARYVGMGLASLVKAFDPGV
VVVGGGLALNAPQAYWEALEEAYRHYLAGWEAPPLRWALLGGEAGLLGAALTAYLEVRDG
GG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggtgggcctggacctggggggcaccaagatcgccgccggggtctttgacggc
acgaggcttctttccaaggtggtccttcccacccccgaggaaggcgggatggcggtggtg
caggccctggccgaggctaccaggaaagcggaggcggaggctggggtggagggtgtggcc
atcggcctgggcaccccggggcccctggactttaaggagggggtgatccgcttcaccccc
aacatccggggcctggtgaacttccccatccgccgccttctggaggaggccaccaaaagg
cccgtccatctggaaaacgacgccaacgccgccgccttggccgagcaccacctgggagcg
gcaaggggagagggtagctccctcttcctcacggtatccacggggatcgggggtggggtg
gttctgggggggcgggtcttgaggggggaaagaggccagggaggggagctcggccacatc
accctgcttcccggggggccggtgtgcggctgcgggctggagggatgcctcgaggccctg
gcggcgggcagggccctggagcgggaagcctcctacgcctaccaccgcaaggtggatacc
aaggagctcttccagctcttccaggaaggcgagcccagggcccggcgcatcctcctccag
gcagcccgttatgtgggcatgggcctggccagcctggtcaaggccttcgaccccggggtg
gtggtggtgggcgggggacttgccctaaacgcccctcaggcctactgggaagccttggag
gaagcctaccggcactacctggcgggctgggaggctccccccttgcgctgggctcttctg
ggaggggaggctgggctcttgggtgccgccctcaccgcctatctggaggttcgggatgga
ggtgggtaa

DBGET integrated database retrieval system