KEGG   Thermus scotoductus: TSC_c24940Help
Entry
TSC_c24940        CDS       T01414                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tsc  Thermus scotoductus
Pathway
tsc00010  Glycolysis / Gluconeogenesis
tsc00030  Pentose phosphate pathway
tsc00051  Fructose and mannose metabolism
tsc00052  Galactose metabolism
tsc00680  Methane metabolism
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01120  Microbial metabolism in diverse environments
tsc01130  Biosynthesis of antibiotics
tsc01200  Carbon metabolism
tsc01230  Biosynthesis of amino acids
tsc03018  RNA degradation
Module
tsc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSC_c24940 (pfkA)
   00030 Pentose phosphate pathway
    TSC_c24940 (pfkA)
   00051 Fructose and mannose metabolism
    TSC_c24940 (pfkA)
   00052 Galactose metabolism
    TSC_c24940 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    TSC_c24940 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TSC_c24940 (pfkA)
Enzymes [BR:tsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TSC_c24940 (pfkA)
Protein phosphatases and associated proteins [BR:tsc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TSC_c24940 (pfkA)
Messenger RNA biogenesis [BR:tsc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TSC_c24940 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_6 PucR Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADW23090
UniProt: E8PQY1
Position
complement(2336148..2337116)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVFTSGGDAPGMNAAIRAVVRQAYALGLEVIGIRRGYAGMILGEMVPLGVRDVANI
LQRGGTVLLTARSQEFLTEEGRAKAAEKLKAAGIEGLVAIGGDGTFRGAMRLLEEHKVPV
VGVPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHERVFFIEVMGRDSGFIALD
VGLAGGAEVIAVPEEPVDPRAIAEGLLESQRRGKTSSIVVVAEGAYPGGAAGLLAAIQEH
VRVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALAGGTSGVMVGEVEGEVELTPLK
EAVERKKDINRSLLALSRVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcataggggtgtttacttccggcggcgatgccccggggatgaatgcggccatc
agggcggtggtgcgccaggcctatgccttgggcctcgaggtgatcggcatccgccgcggc
tatgcgggcatgatcctgggggagatggtgcccttgggggtgcgggatgtggccaacatc
cttcagcgggggggaaccgtcctcctcaccgcaagaagccaggagttcctcacggaggag
ggccgggccaaggcggcggagaagctcaaagcggcgggcatcgagggcctggtggccatc
ggaggggacggtacctttcgcggggccatgcgccttttggaggagcataaggtccccgtg
gtaggggtgcccggcaccatcgacaacgacctttacggcaccgattacaccattggcttt
gacaccgcggtgaacacggccctcgaggccatagaccgcatccgggataccgcagccagc
cacgagcgggtcttcttcatcgaggtcatggggcgggactccgggttcatcgccctggat
gtggggctggctgggggggccgaggtgatcgccgtgcccgaggaacccgtggaccccagg
gccatcgccgagggcctcctggagtcccaaaggcggggaaaaaccagctccattgtggtg
gtggccgagggcgcctaccccgggggggcggcggggctccttgccgccatccaggagcac
gtgcgggtggaggcccgggtcacggtcctgggccatatccagcgggggggaagccccacc
gccaaggaccgcatcctggcaagccgcctaggggcggcggcggtggaggccctggccggg
gggaccagcggggtcatggtgggggaggtggagggggaggtggagctcacccccctcaag
gaggcggtggagcgtaagaaggacatcaaccgctcccttctggccctgtcgcgggttctg
gccctctag

DBGET integrated database retrieval system