KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0697Help
Entry
Tsac_0697         CDS       T02137                                 

Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00052  Galactose metabolism
tsh00561  Glycerolipid metabolism
tsh00600  Sphingolipid metabolism
tsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tsac_0697
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tsac_0697
   00600 Sphingolipid metabolism
    Tsac_0697
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tsac_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C GHL10 Glyco_hydro_31 GHL6 Melibiase_2
Motif
Other DBs
NCBI-ProteinID: AFK85721
UniProt: I3VT76
Position
738038..740227
Genome map
AA seq 729 aa AA seqDB search
MPIRYYEKSKSFKLDAKDTSYIMAIVDEEKFLGHVYFGEMIPDEDVNYLLRLDEPPYVPS
KNGRDRMSFLDSFPTEYPTSGLGDFREPCLKVMTKSGITACGIFYKSHKIYKGKPKLNGL
PSTFGNEDDCTTLEIKCVDNHLNLEVVLIYTVFEDLDAITRSVKVKNCSDEDIILTRVLS
VCVDFDRIDMDMVTLHGSWAREFHVKRRKVELGKQAVSSYRGETSHQANPFLALMDRNAT
EDFGEVYGFNLIYSGNFLAQVEGCQFDTTRVVMGINPFDFGWKLEPQEEFVAPEVVMVYS
NEGIGKMSRTFHDLYRNHLIRGEYKNKRRPVLINSWEAAYFDFDTDKLLRLAREASKLGI
EMLVMDDGWFGKRNSDNCSLGDWVVNEEKLKGGLKYLVDEVNKLGMKFGIWFEPEMVSPD
SDLYRAHPDWCIHIDGREGTLCRNQYVLDLSRKEVRDYVYGSVSNILRSANIEYVKWDMN
RQLSDVGNCVLPPDRQREIWHRYVLGVYEIMDRLTTEFPHIILENCSGGGGRFDPGMLYF
SPQIWLSDDTDAIERLKIQHGASYVYPVSTMGAHISDCPNHIVGRNTPFETRGLVALSGT
FGYELDVTKISQEDKDMIPKQIEMYKKYNNLIYNGDLYRIGNPFENIEFECVEYVSKDKN
EVLVIYVQILNRPNYHSRRIRLKGLEKDAFYRNEETDEVFSGSALMNGGILIKELKGDFR
GKLFHFVRV
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgccgatacgttattatgagaagtcgaaatcatttaaacttgatgctaaagataccagt
tatataatggctatcgttgatgaagaaaagtttttaggacatgtctactttggagagatg
attcctgatgaagatgtgaattaccttttaagattagatgaacctccttatgttccttca
aagaatggaagagacaggatgtcgtttttagacagcttccctacagaataccctacaagt
ggtttgggggattttagagagccatgtttaaaggttatgacaaagtcaggaattactgcg
tgcgggattttttacaagtctcataaaatatataaaggcaagccaaaattaaatggcttg
ccatcaacgtttggcaatgaagatgactgtactacgcttgaaataaagtgtgttgataat
catttaaatttagaagttgttttgatttatacggtttttgaagatttagatgcaataacg
agaagtgtaaaagtaaaaaattgctctgatgaagatatcatattgacgagagtgttgtcc
gtatgtgttgattttgaccgaattgacatggatatggtaactttacatggctcatgggcc
agagaatttcatgtaaagagaaggaaagttgagcttgggaaacaagctgtttcatcatat
agaggtgagacaagtcatcaggcaaatccgtttttagctttaatggataggaatgccact
gaagattttggtgaagtttatgggtttaaccttatatattctggtaatttcttagcacaa
gtagaaggatgtcagtttgatacaactcgcgttgttatgggtataaatccatttgatttt
ggatggaaacttgaacctcaggaggaatttgtggcaccagaagtagtgatggtctattca
aacgaaggtattgggaaaatgtcacgaacttttcacgatctataccgcaatcatcttata
cgaggtgaatataaaaataaaagaagacctgtccttataaatagctgggaagctgcatat
tttgactttgatactgataagcttttgagattggcaagagaagcatcaaagctgggaatt
gagatgcttgtgatggacgatggttggtttggaaagcggaacagtgataattgttcttta
ggtgattgggtcgtcaatgaagaaaagttaaaaggagggcttaaatatttagtagatgaa
gtaaataaacttggcatgaagtttgggatatggtttgagcctgagatggtttcgccggat
tccgatctttatagggcacatccggattggtgcatacacatagatggaagagaaggtaca
ttgtgccgcaatcaatatgtattggatttgtccagaaaggaagtcagagattacgtttat
ggaagcgtaagcaatattttacgcagtgcaaacatagaatatgtaaagtgggatatgaat
aggcagcttagcgatgtcggaaattgtgtattgccacccgatcgtcagagagaaatatgg
cacagatatgttttaggcgtatatgaaattatggacaggcttacgacagaatttccgcat
atcattttggaaaattgctctggaggaggagggcgctttgaccctggaatgctgtatttc
agccctcagatatggctttcagatgatacagatgcgattgagaggcttaaaatccagcat
ggggcttcatacgtatatcctgtatcaacaatgggtgcccacataagcgattgtccaaac
cacattgttggaagaaacactccttttgagacgagaggacttgtagcattgtccgggact
tttggatatgaattggatgttacaaagatatctcaggaagacaaggacatgatacctaag
caaatagagatgtacaaaaagtacaataatttgatatacaatggggatttataccgtata
ggaaatccatttgaaaatatagagtttgaatgcgtagagtatgtttcaaaggacaagaat
gaggtgcttgttatatacgttcaaatcttgaataggcccaattaccacagcagaagaatc
cgattgaagggccttgagaaagatgctttttatcgcaacgaggagacagatgaagttttt
tcaggaagcgctcttatgaacggtggaatcctcataaaagaattgaaaggagactttaga
ggaaaattgtttcactttgtacgggtgtaa

DBGET integrated database retrieval system