KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1188Help
Entry
Tsac_1188         CDS       T02137                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00051  Fructose and mannose metabolism
tsh00520  Amino sugar and nucleotide sugar metabolism
tsh01100  Metabolic pathways
tsh01110  Biosynthesis of secondary metabolites
tsh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Tsac_1188
   00520 Amino sugar and nucleotide sugar metabolism
    Tsac_1188
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Tsac_1188
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     Tsac_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 PGM_PMM_I BOF Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AFK86199
UniProt: I3VUK4
Position
1230072..1232417
Genome map
AA seq 781 aa AA seqDB search
MKAIIMAGGEGSRLRPLTCGIPKPMVPMAGKPAIWHIINHVQKHGINDVGVTLFYLPHKI
KDYLYEQYGDVIKYYVEDKPLGTAGSVKNAADFLDDTFVVISGDVITDIDLKKAYEFHKN
KGSKVTLVLTRVDIPLEYGVVITDDEGKIVKFLEKPSWGEVFSDTVNTGIYIIEPEILNF
IPENRQFDFSKDLFPMLLEKKVPVYGYVSNDYWCDIGNGVQYLKSHLDLLSGYIDLGFKE
KISKDGMIFGKNVFVSRNAKLVPPLIIGDNSVIDDGAVIGPNVIIGSGSYVGHMSTLKNS
VLWDNIKIGRNNEIRGTVFCSGAITENNVRTFDNSIIGEKSKLQSFCEIKPNAKIWPNRI
ISTGNIVERDVVWGNNNEASLFGDRGIKGNLHDNLTPDNLVRLGEVIGSVFDGDILVGCV
DDSYARLALNLLKDGIISAGKKVYNAHSTILPAMRYSIRKNGYKAGVFVKKLDEKTINII
LIDEKGCDVDRNVEKKVLNKYKINDYNIAYAINDEVIVDVNKEYAESLSLNGDSIGNLNV
KFIGKATKSLLSVLNQNRDYKKSVANYDMGIKISDDGENVEIYDDEGHLLDEDELDYLRM
LVVKENGKSKFIIPFNSSQFLSEMSKELGIETRFSKISQLEKMKKMFEIESNNGDGNSQF
SLSFDGINFTLRLIEYLSKKKLKLSDLKKSIPQRVKLNKVINCDWKDKGLIIRKFYEKKD
EKSMFLDGIRFNYGDAWVLLVPDSELPACKIYSEAPTKEKAESLLNEYVEYVYEIIKSKD
S
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgataatcatggctggtggtgagggcagcaggttaaggccattgacgtgcgga
attcctaagcctatggtacctatggctgggaagccagctatttggcatattataaaccat
gtgcaaaagcatggcataaatgatgtgggtgtaacccttttttatttgcctcacaagata
aaagattatttgtatgagcaatacggtgacgtgataaagtattatgtggaagataaacca
cttggaacagcaggcagcgtgaagaatgctgctgattttcttgatgatacatttgtcgta
ataagcggtgatgtgataacagatatagatctaaaaaaagcttatgagtttcataaaaat
aaaggttcaaaagtaacattggtgcttacaagagtagatattccattagagtatggtgtc
gtaataacagatgatgagggaaaaatcgtaaagtttttagaaaagccatcatggggagag
gtgtttagcgatactgtaaatacaggaatttacatcatagagccagagattttaaatttc
atacctgaaaacagacaatttgactttagcaaagatttatttccaatgctgcttgaaaaa
aaggttcctgtttacgggtatgtcagcaatgattactggtgcgacatagggaatggagtt
caataccttaaaagtcatctggatcttttaagtgggtatatcgatcttggcttcaaagag
aagataagcaaagatggaatgatttttggtaaaaatgtatttgtatcacgaaatgccaag
cttgttccgcctttaataataggcgataattcagtaatagatgatggtgcagtaattggg
ccgaatgtaattattggaagtggaagctatgtaggacatatgtcaacattaaaaaacagt
gtgctttgggataatataaagatcggtagaaacaacgaaatcagaggaacggtattttgc
agcggagcaattaccgaaaataacgtcaggacatttgataattcaataataggtgaaaaa
tctaagcttcaatctttttgtgagattaaaccaaacgcgaaaatatggcccaatagaatc
atatcaacagggaatatagtagaaagagatgttgtgtggggaaataacaatgaagcgtcg
ctatttggagatagagggataaaggggaatttgcatgataatcttacacctgacaatttg
gtaagattaggtgaagtaataggcagcgtatttgatggagatatacttgtgggatgtgtt
gatgattcttatgcaagattagccttaaatttattaaaagatgggataatttcagcgggt
aaaaaggtgtacaatgctcattctaccatactgcctgctatgaggtattctattagaaaa
aacggatataaagcaggtgtatttgtgaaaaaattagatgaaaaaacgataaacattatt
ttaatagatgagaaggggtgtgatgtagacagaaatgtagaaaaaaaggtattgaataaa
tacaagatcaacgattataatatagcctatgctataaatgatgaagtcatagtagatgta
aacaaagagtatgctgaaagtttatctttaaacggtgattccattggaaatttaaacgta
aaatttattggtaaagccacaaaaagtttattgagtgtgttgaatcaaaatcgcgattat
aaaaaatctgtggcaaattacgatatgggcattaagatttcagatgatggagaaaatgtt
gaaatttatgatgacgagggacatttgcttgatgaagatgaattggattatttgagaatg
cttgttgtaaaggaaaatgggaaaagtaagtttataataccattcaatagttcccaattt
ttaagtgaaatgtcgaaagagcttggcatcgagacgaggtttagtaaaatctctcagctt
gagaagatgaagaaaatgtttgaaattgaaagtaataatggtgatgggaattctcagttt
agccttagctttgacggcataaatttcacattaaggctaattgaatatttaagcaaaaaa
aagcttaaattatctgatttaaagaaatctataccgcagagggtgaaattgaacaaagtg
ataaattgtgattggaaggataagggattaataataagaaagttttacgaaaaaaaggac
gaaaaatcaatgtttttagatgggataaggtttaattacggtgacgcttgggttttgtta
gttccagattcagagctgcctgcatgtaaaatatactcagaggcccccacaaaggaaaaa
gcagaatcactgttaaacgagtatgtagaatatgtatatgaaataataaagtctaaagac
agttaa

DBGET integrated database retrieval system