KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1255Help
Entry
Tsac_1255         CDS       T02137                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00010  Glycolysis / Gluconeogenesis
tsh00052  Galactose metabolism
tsh00500  Starch and sucrose metabolism
tsh00520  Amino sugar and nucleotide sugar metabolism
tsh00521  Streptomycin biosynthesis
tsh01100  Metabolic pathways
tsh01110  Biosynthesis of secondary metabolites
tsh01120  Microbial metabolism in diverse environments
tsh01130  Biosynthesis of antibiotics
tsh01200  Carbon metabolism
Module
tsh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsac_1255
   00052 Galactose metabolism
    Tsac_1255
   00500 Starch and sucrose metabolism
    Tsac_1255
   00520 Amino sugar and nucleotide sugar metabolism
    Tsac_1255
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tsac_1255
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tsac_1255
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tsac_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Robl_LC7 Hydant_A_N Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AFK86266
UniProt: I3VUS1
Position
1301754..1302689
Genome map
AA seq 311 aa AA seqDB search
MRIGVDIGGTNIAVGLVDKDGKIVATGSRPTEPKRGYAAIAKDIAEISLELVKRCGLDVS
QIEAMGIGVPGVADNEKGIVLRAVNLYWTKVPLVKEIHKYIDVPINMDNDANVAALAEGI
FGAGKGTNSSVTITLGTGVGSGYILNGKVFNGSHHFAPELGHIVIGDNGVLCNCGKVGCL
ETFASATALIREGKKAVMENSDSLILKLAGGEIESITAKNVIDAARQFDEAAMLIFDDYV
KHLAIGIVNIINILDPEVVIIGGGVANAGDFLLKPLKEEVSKNILFKDLPYADIRKAELG
NDAGIIGAAIL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaggattggtgttgatataggagggacaaacatagctgttggattagtcgacaaagac
ggtaagatagtagccacaggatcaaggcctacagagcctaagagaggatatgccgccatt
gctaaagatattgctgaaatttcattggagcttgtgaaaaggtgtgggcttgatgtatct
caaattgaggctatgggaattggtgttccaggtgttgctgataatgaaaaaggcattgtt
ttaagagctgtaaatctctattggacgaaggtgccgttagtaaaggaaatacataaatac
atcgatgtgcctataaacatggataacgatgcaaatgtagctgcacttgcagaaggcata
tttggagctggaaaaggtacaaattcgtctgtcaccataactctaggcacaggtgtaggt
tctggatatatattaaatggcaaggtgtttaacggttcgcaccattttgcccctgagctg
ggtcacattgtgattggcgacaatggggttttgtgcaattgcggcaaggttggctgtctt
gagacttttgcttctgcgacggctttaatcagagaaggcaaaaaagccgtcatggaaaac
agcgattcgcttatacttaaattggctggcggtgagattgaatccataacggctaaaaat
gtaattgatgctgcaagacaatttgacgaagcggcaatgctcatatttgatgactacgta
aagcatcttgccataggaatcgttaatatcataaacatacttgatccagaagttgtcatc
ataggaggcggcgttgccaatgctggtgatttccttctaaagccacttaaagaagaagta
agcaaaaatatacttttcaaagatctgccgtatgctgacatcagaaaggcagagcttgga
aatgatgcaggaataataggtgcggcaattctctaa

DBGET integrated database retrieval system