KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1476Help
Entry
Tsac_1476         CDS       T02137                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00040  Pentose and glucuronate interconversions
tsh00052  Galactose metabolism
tsh00500  Starch and sucrose metabolism
tsh00520  Amino sugar and nucleotide sugar metabolism
tsh01100  Metabolic pathways
tsh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tsac_1476
   00052 Galactose metabolism
    Tsac_1476
   00500 Starch and sucrose metabolism
    Tsac_1476
   00520 Amino sugar and nucleotide sugar metabolism
    Tsac_1476
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tsac_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFK86483
UniProt: I3VVD8
Position
1556254..1557162
Genome map
AA seq 302 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVNSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKGKENLLSLVEDITNMVDIHYIRQKEPKGLGHAIYCARTFV
GDEPFAVLLGDDIVDAKVPVLKQMIEQYERYNCSIIGVQEVPKSEVDKYGIVDANMIDDR
LYRVNNLIEKPRIDEAPSNMAILGRYIISPKIFEILEDVKPGAGGEIQLTDALKLLLEYE
AIYAYDFEGKRYDVGDKMGYLKATIEYALKRDDLKDEFRKYLKEIAATAEKYYEEVAIHS
EK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcgataatacctgcggcagggcttgggacaagatttttgcctgca
acaaaagcacagccaaaagaaatgctgccaatagtagacaaacctacgattcagtatata
gttgaagaagctgtaaactctggcatagaagacatactcataataaccggaagaaataaa
agagccatagaagaccacttcgacaaatcagtggaattagaattagagcttaagaagaaa
ggcaaagaaaatcttttaagcctcgttgaagacataacaaacatggttgacatacattat
ataaggcagaaagagccaaaaggattgggccatgccatctactgtgccagaacatttgta
ggcgatgagccttttgcagttttattaggagatgatatagttgatgcaaaagtgccagta
ttaaaacagatgatagagcagtatgaaaggtacaactgttcaataataggtgtacaagag
gtgccaaagagcgaagtagacaaatacggcatagtagacgccaatatgattgatgatagg
ctttatagagtaaacaacctaatagagaaaccaaggatagatgaagcgccatcgaacatg
gcgatattaggaaggtatataatatctcccaagatatttgagatattggaagatgtaaaa
cctggagcaggaggagagatacagcttacagacgcacttaaattgctattggagtatgaa
gccatatacgcgtatgatttcgaagggaaaaggtacgatgtaggagacaagatggggtac
ttgaaggcaacgatagagtacgccttaaagcgagatgatttgaaggatgaatttagaaaa
tacttaaaagaaattgcggctactgccgaaaaatattatgaagaggtcgctatacacagt
gaaaaataa

DBGET integrated database retrieval system